Any feedback?
Please rate this page
(all_enzymes.php)
(0/150)

BRENDA support

3.4.24.11: neprilysin

This is an abbreviated version!
For detailed information about neprilysin, go to the full flat file.

Word Map on EC 3.4.24.11

Reaction

preferential cleavage of polypeptides between hydrophobic residues, particularly with Phe or Tyr at P1' =

Synonyms

Abeta-degrading enzyme, acute lymphoblastic leukemia antigen, antigen, CALLA (common acute lymphoblastic leukemia-associated), atriopeptidase, CALLA, CALLA (common acute lymphoblastic leukemia-associated) antigens, CALLA antigen, CALLA glycoproteins, CD10, CD10/neutral endopeptidase, CD10/neutral endopeptidase 24.11, common acute lymphoblastic leukemia antigen, common acute lymphoblastic leukemia-associated antigens, Common acute lymphocytic leukemia antigen, endopeptidase CD10, Endopeptidase-2, endopeptidase-24.11, enkephalinase, EP24.11, glycoprotein, CALLA, kidney-brush-border neutral endopeptidase, kidney-brush-border neutral peptidase, kidney-brush-border neutral proteinase, membrane metallo-endopeptidase, membrane metalloendopeptidase, MME, NEP, NEP 24.11, NEP, enkephalinase, neutrophil cluster-differentiation antigen 10, common acute lymphoblastic leukemia antigen, NEP-1, NEP/CD10, NEP2, NEP4A, NEP4B, neprilypsin, neprilysin, neprilysin 4, neutral endopeptidase, neutral endopeptidase 24.11, neutral endopeptidase 24.11/CD10, neutral metallendopeptidase, NL-1, peptidase, endo-, peptidase, membrane metalloendo-, SEP, skin fibroblast elastase

ECTree

     3 Hydrolases
         3.4 Acting on peptide bonds (peptidases)
             3.4.24 Metalloendopeptidases
                3.4.24.11 neprilysin

Substrates Products

Substrates Products on EC 3.4.24.11 - neprilysin

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
SUBSTRATE
PRODUCT                       
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
Reversibility
r=reversible
ir=irreversible
?=not specified
(7-methoxycoumarin-4-yl)acetyl-Arg-Pro-Pro-Gly-Phe-Ser-Ala-Phe-Lys(2,4-dinitrophenyl) + H2O
?
show the reaction diagram
a bradykinin-based peptide substrate QFS
-
-
?
(7-methoxycoumarin-4-yl)acetyl-Arg-Pro-Pro-Gly-Phe-Ser-Ala-Phe-Lys-(2,4-dinitrophenyl) + H2O
(7-methoxycoumarin-4-yl)acetyl-Arg-Pro-Pro-Gly-Phe-Ser-Ala + Phe-Lys-(2,4-dinitrophenyl)
show the reaction diagram
bradykinin-based quenched fluorescent substrate assay
-
-
?
2 KFRRQRPRLSHKGPMPF + 2 H2O
KFRRQRPR + LSHKGPMPF + KFRRQRPRL + SHKGPMPF
show the reaction diagram
-
-
-
ir
2 LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF + 2 H2O
LVQPRGSRNGPGPWQGGRRKFRRQRPRL + SHKGPMPF + LVQPRGSRNGPGPWQGGRRKFRRQRPR + LSHKGPMPF
show the reaction diagram
-
-
-
ir
2 pGlu-RPRLSHKGPMPF + 2 H2O
pGlu-RPRL + pGlu-RPR + SHKGPMPF + LSHKGPMPF
show the reaction diagram
-
-
-
ir
2-aminobenzoyl-ARFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-AR + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-DRFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-DR + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-FRFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-FR + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-HRFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-HR + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-IRFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-IR + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-KRFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-KR + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-LRFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-LR + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-NRFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-NR + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-RAFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-RA + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-RDFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-RD + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-REFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-RE + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-rGF-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-D-Arg-Gly + Phe-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-RGFK(Dnp)-OH + H2O
2-aminobenzoyl-RG + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-RGFK-2,4-dinitrophenyl amide + H2O
2-aminobenzoyl-RG + FK-2,4-dinitrophenyl amide
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-RGFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-RG + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-rGL-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-D-Arg-Gly + Leu-N-(2,4dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-rGV-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-D-Arg-Gly + Val-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-RHFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-RH + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-RKFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-RK + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-RNFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-RN + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-RPFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-RP + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-RQFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-RQ + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-RRFK-2,4-dinitrophenyl amide + H2O
2-aminobenzoyl-RR + FK-2,4-dinitrophenyl amide
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-RRFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-RR + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-rRL-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-D-Arg-L-Arg + Leu-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-RSFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-RS + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-rSL-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-D-Arg-L-Ser + Leu-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-RTFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-RT + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-SRFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-SR + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-TRFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-TR + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-VRFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-VR + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-WRFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-WR + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
2-aminobenzoyl-YRFK-2,4-dinitrophenyl ester + H2O
2-aminobenzoyl-YR + FK-2,4-dinitrophenyl ester
show the reaction diagram
-
-
-
-
ir
Abz-QRPRLSH-(3-nitro)Tyr + H2O
Abz-QRPRL + Ser-His-(3-nitro)Tyr
show the reaction diagram
-
-
-
ir
adrenocorticotropic hormone + H2O
?
show the reaction diagram
-
-
-
-
?
adrenomedullin + H2O
?
show the reaction diagram
-
-
-
?
Ala-Leu-enkephalin + H2O
?
show the reaction diagram
-
-
-
-
?
Aldolase + H2O
?
show the reaction diagram
-
-
-
-
?
alpha-endorphin + H2O
?
show the reaction diagram
-
-
-
?
alpha-neoendorphin + H2O
?
show the reaction diagram
amyloid beta peptide + H2O
?
show the reaction diagram
amyloid beta peptide Abeta42 + H2O
?
show the reaction diagram
-
the peptide primarily undergoes degradation by NEP in vivo in the brain
-
-
?
amyloid beta peptide1-40 + H2O
?
show the reaction diagram
amyloid beta peptide1-40 + H2O
amyloid beta peptide Asp1-Lys16 + amyloid beta peptide Asp1-Leu17 + amyloid beta peptide Asp1-Phe19
show the reaction diagram
the wild-type enzyme cleaves Ab1-40 predominantly at Lys16-Leu17, Leu17-Val18 and Phe19-Phe20. The mutant G399V/G714K cleaves preferentially at Phe20-Ala21
main cleavage fragments after 60 min with the wild-type enzyme. After 360 min these fragments are degraded further, accompanied by the appearance of Val12-Leu17 and Tyr10-Leu17 fragments
-
?
amyloid beta peptide1-42 + H2O
?
show the reaction diagram
amyloid beta(1-40) mutant A21G + H2O
?
show the reaction diagram
-
Flemish variant of amyloid beta. Decreased degradation by neprilysin compared to either wild-type peptide or the other mutant peptides
-
-
?
amyloid beta(1-40) mutant D23N + H2O
?
show the reaction diagram
-
Iowa variant of amyloid beta
-
-
?
amyloid beta(1-40) mutant E22G + H2O
?
show the reaction diagram
-
Arctic variant of amyloid beta
-
-
?
amyloid beta(1-40) mutant E22K + H2O
?
show the reaction diagram
-
Italian variant of amyloid beta
-
-
?
amyloid beta(1-40) mutant E22Q + H2O
?
show the reaction diagram
-
Dutch variant of amyloid beta
-
-
?
amyloid beta(1-40) peptide + H2O
?
show the reaction diagram
-
-
-
-
?
amyloid-beta + H2O
?
show the reaction diagram
amyloid-beta(1-7)AAC + H2O
?
show the reaction diagram
a synthetic peptide, design and synthesis of a quenched fluorogenic peptide substrate qf-Abeta(1-7)AAC (with the sequence VHHQKAAC), which has a fluorophore, Alexa-350, linked to the side-chain of its C-terminal cysteine and a quencher, Dabcyl, linked to its N-terminus
-
-
?
amyloid-beta(12-16)AAC + H2O
?
show the reaction diagram
a synthetic peptide, design and synthesis of a quenched fluorogenic peptide substrate qf-Abeta(12-16)AAC (with the sequence VHHQKAAC), which has a fluorophore, Alexa-350, linked to the side-chain of its C-terminal cysteine and a quencher, Dabcyl, linked to its N-terminus. This peptide emits strong fluorescence upon cleavage. qf-Abeta(12-16)AAC is more sensitive to NEP than the previously reported peptide substrates, so that concentrations of NEP as low as 0.03 nM can be detected at peptide concentration of 0.002 mM
-
-
?
amyloid-beta1-40 + H2O
?
show the reaction diagram
amyloid-beta1-40 + H2O
Abeta1-16 + Abeta 1-17 + Abeta1-19
show the reaction diagram
-
-
-
?
amyloid-beta1-42 + H2O
?
show the reaction diagram
amyloid-beta4-40 + H2O
?
show the reaction diagram
a synthetic peptide
-
-
?
amyloid-beta4-42 + H2O
?
show the reaction diagram
a synthetic peptide
-
-
?
angiotensin + H2O
?
show the reaction diagram
-
-
-
?
angiotensin I + H2O
?
show the reaction diagram
angiotensin II + H2O
?
show the reaction diagram
angiotensin III + H2O
?
show the reaction diagram
-
-
-
-
?
angiotensin(1-9) + H2O
?
show the reaction diagram
-
-
-
-
?
Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 + H2O
?
show the reaction diagram
Arg-vasopressin + H2O
?
show the reaction diagram
-
-
-
?
Asp-Tyr(SO3H)-Met-Gly-Trp-Met-Asp-PheNH2 + H2O
?
show the reaction diagram
Atrial natriuretic factor + H2O
?
show the reaction diagram
atrial natriuretic peptide + H2O
?
show the reaction diagram
azocasein + H2O
?
show the reaction diagram
-
-
-
-
?
Azocoll + H2O
?
show the reaction diagram
-
-
-
-
?
benzoyl-Gly-Gly-Arg-Leu-2-naphthylamide + H2O
benzoyl-Gly-Gly-Arg + L-Leu-2-naphthylamide
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-Ala-Gly-Leu-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-Phe-Arg-4-methyl-7-coumarylamide + H2O
?
show the reaction diagram
-
-
-
-
?
beta-amyloid peptide + H2O
?
show the reaction diagram
-
-
-
-
?
beta-endorphin + H2O
?
show the reaction diagram
-
-
-
-
?
beta-lipotropin(61-69) + H2O + H2O
?
show the reaction diagram
beta-neoendorphin + H2O
?
show the reaction diagram
bradykinin + H2O
?
show the reaction diagram
brain natriuretic peptide + H2O
?
show the reaction diagram
-
-
-
?
casein + H2O
?
show the reaction diagram
-
-
-
-
?
cholecystokinin-8 + H2O
?
show the reaction diagram
D-Ala2-Leu5-enkephalin + H2O
?
show the reaction diagram
-
-
-
-
?
D-Ala2-Leu5-enkephalin + H2O
Tyr-D-Ala-Gly + Phe-Leu
show the reaction diagram
D-Ala2-Leu5-enkephalinamide + H2O
?
show the reaction diagram
-
-
-
-
?
dansyl-Gly-Trp-Gly + H2O
dansyl-Gly + Trp-Gly
show the reaction diagram
-
-
-
?
dansyl-Gly-Tyr-Gly + H2O
dansyl-Gly + Tyr-Gly
show the reaction diagram
-
-
-
?
dansyl-Gly-Tyr-Gly-NH2 + H2O
dansyl-Gly + Tyr-Gly-NH2
show the reaction diagram
-
-
-
-
?
dynorphin + H2O
?
show the reaction diagram
dynorphin A-10 + H2O
?
show the reaction diagram
-
-
-
-
?
dynorphin A-13 + H2O
?
show the reaction diagram
-
-
-
-
?
dynorphin A-17 + H2O
?
show the reaction diagram
-
-
-
-
?
dynorphin A-6 + H2O
?
show the reaction diagram
-
-
-
-
?
dynorphin A-8 + H2O
?
show the reaction diagram
-
-
-
-
?
dynorphin A-9 + H2O
?
show the reaction diagram
-
-
-
-
?
dynorphin(1-9) + H2O
?
show the reaction diagram
-
-
-
-
?
Elastin + H2O
?
show the reaction diagram
endothelin-1 + H2O
?
show the reaction diagram
enkephalin + H2O
?
show the reaction diagram
exendin-4 + H2O
?
show the reaction diagram
-
poor substrate
-
-
?
fibrinogen + H2O
fibrin + ?
show the reaction diagram
FMRF amide + H2O
?
show the reaction diagram
galanin + H2O
?
show the reaction diagram
-
-
-
-
?
gamma-endorphin + H2O
?
show the reaction diagram
gastri-releasing peptide + H2O
?
show the reaction diagram
-
-
-
?
gastric inhibitor peptide + H2O
?
show the reaction diagram
-
poor substrate
-
-
?
gastrin + H2O
?
show the reaction diagram
gastrin G-17 + H2O
?
show the reaction diagram
gastrin releasing peptide-10 + H2O
?
show the reaction diagram
GLP-1 + H2O
?
show the reaction diagram
-
-
-
?
GLP-1(7-36)amide + H2O
?
show the reaction diagram
-
insulinotropic peptide hormone
-
-
?
Glucagon + H2O
?
show the reaction diagram
glucagon-like peptide 1 + H2O
?
show the reaction diagram
-
-
-
-
?
glutaryl-Ala-Ala-Phe-2-naphthylamide + H2O
glutaryl-Ala-Ala + Phe-2-naphthylamide
show the reaction diagram
-
-
-
?
glutaryl-Ala-Ala-Phe-4-methoxy-2-naphthylamide + H2O
glutaryl-Ala-Ala + Phe-4-methoxy-2-naphthylamide
show the reaction diagram
glutaryl-Ala-Ala-Phe-4-methoxy-2-naphthylamine + H2O
?
show the reaction diagram
-
-
-
-
?
glutaryl-Gly-Gly-Phe-2-naphthylamide + H2O
glutaryl-Gly-Gly + Phe-2-naphthylamide
show the reaction diagram
-
-
-
?
glutaryl-Gly-Gly-Phe-2-naphthylamide + H2O
glutaryl-Gly-Gly-Phe + 2-naphthylamine
show the reaction diagram
-
-
-
-
?
Gly-Trp-Gly + H2O
?
show the reaction diagram
-
-
-
-
?
haemoglobin + H2O
?
show the reaction diagram
-
-
-
-
?
hippuryl-Arg-Arg-Ala-2-naphthylamide + H2O
hippuryl-Arg-Arg + Ala-2-naphthylamide
show the reaction diagram
-
-
-
-
?
hippuryl-Arg-Arg-Leu-2-naphthylamide + H2O
hippuryl-Arg-Arg + Leu-2-naphthylamide
show the reaction diagram
His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 + H2O
His-Lys-Thr-Asp-Ser + Phe-Val-Gly + Leu-Met-NH2
show the reaction diagram
insulin + H2O
?
show the reaction diagram
-
-
-
?
insulin B chain + H2O
?
show the reaction diagram
interleukin 1beta + H2O
?
show the reaction diagram
Leu-2-naphthylamide + H2O
?
show the reaction diagram
-
-
-
-
?
Leu-enkephalin + H2O
?
show the reaction diagram
-
-
-
-
?
Leu5-enkephalin + H2O
?
show the reaction diagram
Leu5-enkephalin-Arg6 + H2O
?
show the reaction diagram
-
-
-
-
?
Leu5-enkephalinamide + H2O
?
show the reaction diagram
leucine5-enkephalin + H2O
?
show the reaction diagram
Tyr-Gly-Gly-Phe-Leu is cleaved at the Gly-Phe bond by the wild-type enzyme
-
-
?
Luliberin + H2O
?
show the reaction diagram
-
poor substrate
-
-
?
Luteinizing hormone-releasing hormone + H2O
?
show the reaction diagram
Mca-Arg-Pro-Pro-Gly-Phe-Ser-Ala-Phe-Lys-(Dnp)-OH + H2O
?
show the reaction diagram
Mca-RPPGFSAFK-(Dnp) + H2O
?
show the reaction diagram
-
-
-
?
Met-enkephalin + H2O
?
show the reaction diagram
-
-
-
-
?
Met-enkephalin amide + H2O
?
show the reaction diagram
-
-
-
-
?
Met-enkephalin-Arg6-Gly7-Leu + H2O
?
show the reaction diagram
Met-Leu-Phe + H2O
?
show the reaction diagram
Met5-enkephalin-Arg6 + H2O
?
show the reaction diagram
-
-
-
-
?
Met5-enkephalin-Arg6-Phe7 + H2O
?
show the reaction diagram
N-(4-carboxy-1-oxobutyl)-L-alanyl-L-alanyl-N-(4-methoxy-2-naphthalenyl)-L-phenylalaninamide + H2O
N-(4-carboxy-1-oxobutyl)-L-alanyl-L-alanyl-L-phenylalanine + 4-methoxy-2-naphthylamine
show the reaction diagram
-
-
-
?
N-acetyl-Gly-Trp-Gly + H2O
N-acetyl-Gly + Trp-Gly
show the reaction diagram
-
-
-
-
?
N-benzyloxycarbonyl-Gly-Gly-Leu 2-naphthylamide + H2O
N-benzyloxycarbonyl-Gly-Gly + L-leucine 2-naphthylamide
show the reaction diagram
-
-
-
?
N-benzyoxycarbonyl-Gly-Gly-Leu 2-naphthylamide + H2O
?
show the reaction diagram
-
-
-
-
?
N-benzyoxycarbonyl-Gly-Gly-Leu-2-naphthylamide + H2O
N-benzyoxycarbonyl-Gly-Gly + L-Leu-2-naphthylamide
show the reaction diagram
-
-
-
-
?
N-dansyl-Ala-Gly-D-(4-nitro-Phe)-Gly + H2O
?
show the reaction diagram
-
-
-
-
?
N-dansyl-D-Ala-Gly-p-nitrophenyl-Ala-Gly + H2O
?
show the reaction diagram
N-formyl-L-Met-Leu-Phe + H2O
?
show the reaction diagram
-
the enzyme may play an important role in modulating chemotactic response by cleavage of the chemotactic substance N-formyl-Met-Leu-Phe
-
-
?
N-Formyl-Met-Leu-Phe + H2O
N-Formyl-Met + Leu-Phe
show the reaction diagram
-
-
-
?
Na,K-ATPase alpha subunit + H2O
?
show the reaction diagram
-
-
-
-
?
Nalpha-benzoyl-Gly-Arg-Arg-Ala-2-naphthylamide + H2O
Nalpha-benzoyl-Gly-Arg-Arg + Ala-2-naphthylamide
show the reaction diagram
-
-
-
?
Nalpha-benzoyl-Gly-Arg-Arg-Leu-2-naphthylamide + H2O
Nalpha-benzoyl-Gly-Arg-Arg + Leu-2-naphthylamide
show the reaction diagram
-
-
-
?
Nalpha-benzoyl-Gly-Arg-Arg-Phe-2-naphthylamide + H2O
Nalpha-benzoyl-Gly-Arg-Arg + Phe-2-naphthylamide
show the reaction diagram
-
-
-
?
Nalpha-benzoyl-Gly-Arg-Leu-2-naphthylamide + H2O
Nalpha-benzoyl-Gly-Arg + Leu-2-naphthylamide
show the reaction diagram
-
-
-
?
Nalpha-benzoyl-Gly-Gly-Arg-Leu-2-naphthylamide + H2O
Nalpha-benzoyl-Gly-Gly-Arg + Leu-2-naphthylamide
show the reaction diagram
-
-
-
?
Nalpha-benzoyl-Gly-Lys-Arg-Arg-Leu-2-naphthylamide + H2O
Nalpha-benzoyl-Gly-Lys-Arg-Arg + Leu-2-naphthylamide
show the reaction diagram
-
-
-
?
Nalpha-benzoyl-Gly-Lys-Lys-Arg-Arg-Leu-2-naphthylamide + H2O
Nalpha-benzoyl-Gly-Lys-Lys-Arg-Arg + Leu-2-naphthylamide
show the reaction diagram
-
-
-
?
Neurokinin A + H2O
?
show the reaction diagram
-
-
-
?
neurokinin B + H2O
?
show the reaction diagram
neuropeptide Y + H2O
truncated neuropeptide Y + C-terminal fragments of neuropeptide Y
show the reaction diagram
-
-
neuropeptide Y 21-36 and 31-36 are the most abundant fragments generated in vivo
-
?
neurotensin + H2O
?
show the reaction diagram
nociceptin + H2O
?
show the reaction diagram
-
-
-
?
oxytocin + H2O
?
show the reaction diagram
pBNP-26 + H2O
?
show the reaction diagram
-
cleaved at several sites
-
-
?
physalaemin + H2O
?
show the reaction diagram
pulmonary vasodilative vasoactive intestinal peptide + H2O
?
show the reaction diagram
rapid inactivation
-
-
?
pyroglutamyl-Leu-Asn-Phe-Thr-Pro-Asn-Trp-Gly-Thr-NH2 + H2O
pyroglutamyl-Leu-Asn + Phe-Thr-Pro-ASn-Trp-Gly-Thr-NH2
show the reaction diagram
Secretin + H2O
?
show the reaction diagram
-
-
-
-
?
somatostatin 14 + H2O
?
show the reaction diagram
-
-
-
?
somatostatin 28 + H2O
?
show the reaction diagram
-
-
-
?
striatal natriuretic factor + H2O
?
show the reaction diagram
-
-
-
-
?
Substance P + H2O
?
show the reaction diagram
succinyl-Ala-Ala-Phe-4-methylcoumarin 7-amide + H2O
succinyl-Ala-Ala + Phe-4-methylcoumarin 7-amide
show the reaction diagram
succinyl-Ala-Ala-Phe-7-amido-4-methylcoumarin + H2O
?
show the reaction diagram
succinyl-Ala-Ala-Phe-7-amido-4-methylcoumarin + H2O
succinyl-Ala-Ala-Phe + 7-amino-4-methylcoumarin
show the reaction diagram
succinyl-Ala-Ala-Phe-p-nitroanilide + H2O
?
show the reaction diagram
-
-
-
-
?
succinyl-Arg-Arg-Leu-2-naphthylamide + H2O
succinyl-Arg-Arg + Leu-2-naphthylamide
show the reaction diagram
-
-
-
?
succinyl-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-7-amido-4-methylcoumarin + H2O
?
show the reaction diagram
-
-
-
-
?
sulfated cholecystokinin octapeptide + H2O
?
show the reaction diagram
-
-
-
-
?
tachykinin + H2O
?
show the reaction diagram
Q9I7I4
27.8% degradation
-
-
?
Tyr-D-Ala-Gly-Phe-Leu + H2O
Tyr-D-Ala-Gly + Phe-Leu
show the reaction diagram
-
-
-
?
Tyr-D-Ala-Gly-Phe-Met + H2O
Tyr-D-Ala-Gly + Phe-Met
show the reaction diagram
Tyr-D-Ala-Gly-Phe-Met-NH2 + H2O
Tyr-D-Ala-Gly + Phe-Met-NH2
show the reaction diagram
Tyr-Gly-Gly-Phe-Met + H2O
Tyr-Gly-Gly + Phe-Met
show the reaction diagram
Vasoactive intestinal peptide + H2O
?
show the reaction diagram
-
-
-
-
?
Z-Ala-Ala-Leu-4-nitroanilide + H2O
Z-Ala-Ala-Leu + 4-nitroaniline
show the reaction diagram
-
-
-
?
additional information
?
-