Any feedback?
Please rate this page
(all_enzymes.php)
(0/150)

BRENDA support

3.4.24.11: neprilysin

This is an abbreviated version!
For detailed information about neprilysin, go to the full flat file.

Word Map on EC 3.4.24.11

Reaction

preferential cleavage of polypeptides between hydrophobic residues, particularly with Phe or Tyr at P1' =

Synonyms

Abeta-degrading enzyme, acute lymphoblastic leukemia antigen, antigen, CALLA (common acute lymphoblastic leukemia-associated), atriopeptidase, CALLA, CALLA (common acute lymphoblastic leukemia-associated) antigens, CALLA antigen, CALLA glycoproteins, CD10, CD10/neutral endopeptidase, CD10/neutral endopeptidase 24.11, common acute lymphoblastic leukemia antigen, common acute lymphoblastic leukemia-associated antigens, Common acute lymphocytic leukemia antigen, endopeptidase CD10, Endopeptidase-2, endopeptidase-24.11, enkephalinase, EP24.11, glycoprotein, CALLA, kidney-brush-border neutral endopeptidase, kidney-brush-border neutral peptidase, kidney-brush-border neutral proteinase, membrane metallo-endopeptidase, membrane metalloendopeptidase, MME, NEP, NEP 24.11, NEP, enkephalinase, neutrophil cluster-differentiation antigen 10, common acute lymphoblastic leukemia antigen, NEP-1, NEP/CD10, NEP2, NEP4A, NEP4B, neprilypsin, neprilysin, neprilysin 4, neutral endopeptidase, neutral endopeptidase 24.11, neutral endopeptidase 24.11/CD10, neutral metallendopeptidase, NL-1, peptidase, endo-, peptidase, membrane metalloendo-, SEP, skin fibroblast elastase

ECTree

     3 Hydrolases
         3.4 Acting on peptide bonds (peptidases)
             3.4.24 Metalloendopeptidases
                3.4.24.11 neprilysin

Activating Compound

Activating Compound on EC 3.4.24.11 - neprilysin

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
ACTIVATING COMPOUND
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
androgen
-
androgens positively regulate neural expression of neprilysin in adult male rats
-
dihydrotestosterone
-
induces a time-dependent increase in neprilysin expression. Dihydrotestosterone also significantly decreases levels of amyloid beta in androgen receptor-expressing cells transfected with amyloid precursor protein, but does not affect levels of either full-length or non-amyloidogenic, soluble amyloid precursor protein. The dihydrotestosterone-induced decrease of amyloid beta is blocked by pharmacological inhibition of neprilysin. The dihydrotestosterone-mediated increase in neprilysin expression and decrease in amyloid beta levels are not observed in rat pheochromocytoma cell 12 lacking androgen receptor and blocked in androgen receptor-expressing cells by the antagonists, cyproterone acetate and flutamide
estrogen
-
estrogen stimulates degradation of beta-amyloid peptide by up-regulating neprilysin
K49-P1-20
a 20 amino acid peptide from the venom of Bothrops asper, the N-terminal domain of Bothrops asper myotoxin II enhances the activity of neprilysin to 1605% of control. The presence of K49-P1-20 increases the Vmax of NEP by 5.2fold, K49-P1-20 also increases Km of NEP by 3.3fold. N-terminal biotinylation of K49-P1-20 has no significant effect on its ability to stimulate the enzyme, there is only a minimal interaction between the enzyme and the biotinylated version of inverted K49-P1-20. Slight activation of recombinant NEP expressed in HEK-293 cells in vivo
K49-P1-34
the synthetic peptide corresponding to the N-terminal region mimicks the stimulator effects of Bothrops asper myotoxin II
-
minocycline
-
minocycline abrogates the amyloid beta(25-35)-induced decrease of somatostatin-like immunoreactive content, somatostatin mRNA levels, phosphorylated-cAMP-response element binding protein CREB content and neprilysin levels. Minocycline alone enhances these targets
SLFELGKMILQETGKNPAKSYGAYGNCCGVLGRG
the synthetic peptide corresponding to the N-terminal region mimicks the stimulator effects of Bothrops asper myotoxin II
-
additional information
-
both staurosporine-stimulated caspase-3 activation, p53 and neprilysin expression and activity are not affected by over-expression or depletion of presenilin complex component TMP21
-