Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
3,4-dichloroisocoumarin + H2O
?
-
a significant portion of the inhibitor 3,4-dichloroisocoumarin bound to GlpG is enzymatically turned over
-
-
?
adhesin + H2O
?
-
EhROM1 is able to cleave Plasmodium adhesins but not the canonical substrate Drosophila Spitz. It is examined whether EhROM1 can cleave a representative of each of the four families of Plasmodium adhesins: the EBL adhesin BAEBL, the RBL adhesin Rh4, AMA1, and TRAP. All adhesins are efficient substrates for the recoded EhROM1 with the exception of AMA1, which is cleaved less well than the others by EhROM1
-
-
?
adhesin BAEBL + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin CTRP + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin EBA-175 + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin EBP-175 + H2O
?
-
adhesin EBP-175 of Plasmodium falciparum undergoes ectodomain shedding, in a reaction catalyzed by plasmodium rhomboid pfROM4. pfROM4 cleaves within the transmembrane region of the adhesin
-
-
?
adhesin JESEBL + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin MAEBL + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin MTRAP + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin PFF0800c + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin Rh1 + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin Rh24 + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin Rh2a + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin Rh2b + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin TRAP + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesion protein from Toxoplasma gondii + H2O
?
alpha chain of pre-T cell receptor + H2O
?
constitutively active receptor variant required for T cell development. cleavage contributes to ER-associated degradation, cleavage productsare translocated and degraded by the proteasome
-
-
?
apical membrane antigen 1 + H2O
?
-
i.e. AMA1, substrate only of ROM1
-
-
?
apical membrane antigen AMA1 + H2O
?
-
-
-
?
APP-Spi7-Flag + H2O
?
-
-
-
-
?
beta-lactamase Spitz transmembrane domain + H2O
?
-
34 residue peptide, sequence KRPRPMLEKASIASGAMCALVFMLFVCLAFYLRK
-
-
?
beta-lactamase-Spitz transmembrane segment-maltose binding protein + H2O
?
-
a fusion protein containing the Spitz TM segment fused to globular proteins at the N- and C-termini (beta-lactamase and maltose binding protein, respectively)
-
-
?
Bla-GknTM-MBP + H2O
?
-
recombinantly expressed fusion protein having the transmembrane region of Gurken, GknTM, a physiological substrate of Drosophila rhomboids, GlpG cleaves an extramembrane region of the substrate exposed to the periplasm, overview
-
-
?
C100Tat-Flag + H2O
?
C100Tat-Flag is a chimera of the C-terminal 100 residues of APP, with seven residues of the Pseudomonas stuartii TatA cleavage site substituted at the N-terminus
-
-
?
Ccp1 + H2O
?
-
Ccp1 is a mitochondrial cytochrome c peroxidase its cleavage side resides in a short stretch of moderately hydrophobic sequence
-
-
?
chimeric protein of the bacterial pelB leader peptide, GFP as the extracellularectodomain, the juxtamembrane-transmembrane-cytosolic residues 122-230 of Spitz and a C-terminal epitope + H2O
?
CyPet-TatA-YPet + H2O
?
-
engineered substrate based on transmembrane substrate TatA from Providencia stuartii, suitable for FRET assay
-
-
?
cytochrome c peroxidase + H2O
processed cytochrome c peroxidase + targeting sequence peptide
-
cleaving the targeting sequence of cytochrome c peroxidase, Pcp1
-
-
?
cytochrome c peroxidase Ccp1 + H2O
?
-
cleavage of Ccp1 by Pcp1/Rbd1 appears to occur directly after or within its hydrophobic sorting sequence
-
-
?
cytochrome c peroxidase precursor + H2O
cytochrome c peroxidase + ?
Delta-transmembrane domain + H2O
?
dynamin-like GTPase + H2O
?
-
-
-
-
?
epidermal growth factor + H2O
?
-
efficient and specific substrate for rhomboid protease RHBDL2
-
-
?
growth factor Spitz + H2O
?
growth-factor gurken + H2O
?
-
-
-
-
?
growth-factor spitz + H2O
?
-
-
-
-
?
Gurken protein + H2O
?
-
-
-
-
?
Gurken protein + H2O
PQRKVRMA + HIVFSFFV
Gurken-derived peptide + H2O
?
Gurken-transmembrane domain + H2O
?
Keren protein + H2O
?
-
-
-
-
?
l-Mgm1 + H2O
s-Mgm1 + N-terminal putative transmembrane segment
LacY trans-membrane domain 2 + H2O
?
LacYTM2 protein + H2O
DINHISKS + DTGIIFAA
large isoform of Mgm1 + H2O
short isoform of Mgm1 + ?
lectin + H2O
?
-
EhROM1 is able to cleave cell surface lectin
-
-
?
microneme protein MIC2 + H2O
?
-
-
-
?
microneme protein MIC6 + H2O
?
-
-
-
?
myelin protein zero mutant L170R + H2O
?
mutant form is unstable and efficiently cleaved by isoform RHBDL4. Wild-type myelin protein zero is not a substrate
-
-
?
N-acetyl-PEG4-QRKVRMAHIVFSFPC-amide + H2O
N-acetyl-PEG4-QRKVRMA + HIVFSFPC-amide
Opa-1 + H2O
?
-
genetic analysis shows that Opa1 and Parl are part of the same pathway, with Parl positioned upstream of Opa1 in the control of apoptosis
-
-
?
opsin mutant bearing TCRalpha degron motif + H2O
?
opsin-degron mutant is degraded by isoform RHBDL4, whereas the wild-type protein is stable
-
-
?
phosphoglycerate mutase 5 + H2O
?
mitochondrial Ser/Thr protein phosphatase PGAM5
substrate is cleaved in its N-terminal transmembrane domain in response to mitochondrial membrane potential loss and mediated by presenilin-associated rhomboid-like protein. In response to membrane potential loss, the enzyme dissociates from substrate PINK1, a mitochondrial Ser/Thr protein kinase, and reciprocally associates with substrate PGAM5. Results suggest that the enzyme mediates differential cleavage of PINK1 and PGAM5 depending on the health status of mitochondria
-
?
polycystin-1 + H2O
?
11-TM spanning membrane protein. Isoform RHBDL4 cleaves several truncated versions of polycystin-1 at luminal loops or juxtamembrane transmembrane regions. Wild-type olycystin-1 is not a substrate
-
-
?
Protein + H2O
?
-
cleaves a model protein having an N-terminal and periplasmically localized beta-lactamase domain, a LacY-derived transmembrane region, and a cytosolic maltose binding protein mature domain, cleavage occurs between Ser and Asp in a region of high local hydrophilicity, which might be located iin a juxtamembrane rather than an intramembrane position. The conserved Ser and His residue of GlpG are esential for proteolytic activity
-
-
?
protein Bla-LY2-MBP + H2O
?
protein MIC2 + H2O
?
-
cleavage at an Ala-Gly bond
-
-
?
reporter substrate LY2
?
-
using a combinatorial approach it is shown that a negatively charged residue is the primary determinant of cleavage. The amino acid preceding peptide bond hydrolysis (the P1 position) has a preference for the small and polar Ser residue. The amino acid succeeding peptide bond hydrolysis (the P1 position) has a preference for negatively charged Asp
-
-
?
Spitz-polyA + H2O
?
-
-
-
-
?
Spitz-transmembrane domain + H2O
?
TatA + H2O
processed TatA + N-terminal extension peptide
TatA protein + H2O
?
-
-
-
-
?
TatA protein + H2O
MESTIATA + AFGSPWQL
thrombomodulin + H2O
soluble thrombomodulin + ?
-
-
-
-
?
Tic40 + H2O
?
-
i.e. the chloroplast inner envelope translocon component of 40 kDa
-
-
?
trans-membrane domain + H2O
?
trans-membrane domain Gurken + H2O
?
additional information
?
-
adhesin MIC2 + H2O

?
-
-
-
?
adhesin MIC2 + H2O
?
-
the ectodomain of Toxoplasma gondii adhesin MIC2, a type-I membrane protein is cleaved by rhomboid
-
-
?
adhesion protein from Toxoplasma gondii + H2O

?
-
MIC-2, MIC-6 and MIC-12 are efficient substrates
-
-
?
adhesion protein from Toxoplasma gondii + H2O
?
-
MIC-2, MIC-6 and MIC-12 are efficient substrates
-
-
?
BODIPY FL casein + H2O

?
-
-
-
-
?
BODIPY FL casein + H2O
?
-
commercially available fluorescent substrate
-
-
?
C100Spi-Flag + H2O

?
-
no cleavage of C100-Flag
-
-
?
C100Spi-Flag + H2O
?
-
no cleavage of C100-Flag
-
-
?
C100Spi-Flag + H2O
?
-
no cleavage of C100-Flag
-
-
?
C100Spi-Flag + H2O
?
-
no cleavage of C100-Flag
-
-
?
chaperone Star + H2O

?
-
cleavage of Star within its transmembrane domain both in cell culture and in flies, the enzyme is involved in regulation of levels of Spitz, the major Drosophila EGF receptor ligand, mechanism for modulating the activity of Star, thereby influencing the levels of active Spitz ligand, intracellular trafficking of Spitz isimpaired by Rhomboid-dependent cleavage of Star, overview
-
-
?
chaperone Star + H2O
?
-
a type II transmembrane protein, cleavage in the transmembrane sequence 298IVYMoxDTTEIRHQQF311
-
-
?
chimeric protein of the bacterial pelB leader peptide, GFP as the extracellularectodomain, the juxtamembrane-transmembrane-cytosolic residues 122-230 of Spitz and a C-terminal epitope + H2O

?
-
-
-
-
?
chimeric protein of the bacterial pelB leader peptide, GFP as the extracellularectodomain, the juxtamembrane-transmembrane-cytosolic residues 122-230 of Spitz and a C-terminal epitope + H2O
?
-
-
-
-
?
cytochrome c peroxidase precursor + H2O

cytochrome c peroxidase + ?
-
-
-
-
?
cytochrome c peroxidase precursor + H2O
cytochrome c peroxidase + ?
-
-
-
?
Delta-transmembrane domain + H2O

?
-
slight activity
-
-
?
Delta-transmembrane domain + H2O
?
-
slight activity
-
-
?
ephrin B3 + H2O

?
-
RHBDL-2 mediated proteolytic processing may regulate intercellular interactions between ephrinB3 and eph receptors
-
-
?
ephrin B3 + H2O
?
-
cleaved efficiently, appears to be cleaved in its membrane domain
-
-
?
FL-casein + H2O

?
-
-
-
-
?
FL-casein + H2O
?
-
-
-
-
?
FL-casein + H2O
?
-
-
-
-
?
FL-casein + H2O
?
-
-
-
-
?
growth factor Spitz + H2O

?
-
-
-
-
?
growth factor Spitz + H2O
?
-
Rhomboid-1
-
-
?
growth factor Spitz + H2O
?
-
Rhomboid-1 is important in extracellular signal production, overview
-
-
?
Gurken + H2O

?
-
-
-
?
Gurken + H2O
?
-
cleavage by rhomboid 4
-
-
?
Gurken protein + H2O

PQRKVRMA + HIVFSFFV
-
-
-
-
?
Gurken protein + H2O
PQRKVRMA + HIVFSFFV
-
-
-
-
?
Gurken protein + H2O
PQRKVRMA + HIVFSFFV
-
-
-
-
?
Gurken-derived peptide + H2O

?
-
-
-
-
?
Gurken-derived peptide + H2O
?
-
-
-
-
?
Gurken-transmembrane domain + H2O

?
-
-
-
-
?
Gurken-transmembrane domain + H2O
?
-
-
-
-
?
Gurken-transmembrane domain + H2O
?
-
-
-
?
Gurken-transmembrane domain + H2O
?
-
-
-
-
?
Gurken-transmembrane domain + H2O
?
-
-
-
-
?
Keren + H2O

?
-
-
-
?
Keren + H2O
?
-
Rho-1 recognizes a common region of the transmembrane helix substrate that contains small residues (Gly,Ser,Ala)
-
-
?
Keren + H2O
?
-
cleavage by rhomboid 4
-
-
?
Keren + H2O
?
-
inefficient cleavage
-
-
?
l-Mgm1 + H2O

s-Mgm1 + N-terminal putative transmembrane segment
-
rhomboid-type protease Pcp1 is essential for wild type mitochondrial morphology. The processing of the large isoform l-Mgm1 by rhomboid-type protease Pcp1 to s-Mgm1, and the presence of both isoforms of Mgm1 appears to be crucial for wild-type mitochondrial morphology and maintenance of mitochondrial DNA
-
-
?
l-Mgm1 + H2O
s-Mgm1 + N-terminal putative transmembrane segment
-
l-Mgm1 is the large isoform of Mgm1
s-Mgm1 is the small isoform of Mgm1
-
?
LacY trans-membrane domain 2 + H2O

?
-
LacY trans-membrane domain 2 of Escherichia coli is engineered into a fusion protein backbone that includes a signal peptide and maltose-binding protein N-terminal to the trans-membrane domain, and a thioredoxin domain and His tag at the C terminus. Substrate is cleaved at the same position by different bacterial rhomboids. Insertion into a fusion protein does not affect cleavage
-
-
?
LacY trans-membrane domain 2 + H2O
?
LacY trans-membrane domain 2 of Escherichia coli is engineered into a fusion protein backbone that includes a signal peptide and maltose-binding protein N-terminal to the trans-membrane domain, and a thioredoxin domain and His tag at the C terminus. Substrate is cleaved at the same position by different bacterial rhomboids. Insertion into a fusion protein does not affect cleavage
-
-
?
LacY trans-membrane domain 2 + H2O
?
LacY trans-membrane domain 2 of Escherichia coli is engineered into a fusion protein backbone that includes a signal peptide and maltose-binding protein N-terminal to the trans-membrane domain, and a thioredoxin domain and His tag at the C terminus. Substrate is cleaved at the same position by different bacterial rhomboids. Insertion into a fusion protein does not affect cleavage
-
-
?
LacYTM2 protein + H2O

DINHISKS + DTGIIFAA
-
-
-
-
?
LacYTM2 protein + H2O
DINHISKS + DTGIIFAA
-
-
-
-
?
LacYTM2 protein + H2O
DINHISKS + DTGIIFAA
-
-
-
-
?
large isoform of Mgm1 + H2O

short isoform of Mgm1 + ?
-
-
-
-
?
large isoform of Mgm1 + H2O
short isoform of Mgm1 + ?
-
the enzyme is involved in the pathway of Mgm1 biogenesis. A strong shift in the ratio between both isoform of Mgm1 is sufficient to alter mitochondrial morphology
-
-
?
Mgm1 + H2O

?
-
cleaving the long isoform of Mgm1 to produce the short one
-
-
?
Mgm1 + H2O
?
-
Mgm1 is a dynamin-like GTPase its cleavage side resides in a short stretch of moderately hydrophobic sequence
-
-
?
Mgm1p + H2O

?
-
inner membrane dynamin-related protein is cleaved by Pcp1/Rbd1. In Mgm1p, substituting GlyGlyMet in the predicted transmembrane helix with bulkier ValValLeu blocks Pcp1/Rbd1-mediated cleavage, suggesting that the GlyGly substrate motif of RHO rhomboids is also important for PARL rhomboids
-
-
?
Mgm1p + H2O
?
-
transmembrane helix Mgm1p (inner membrane dynamin-related protein) of Schizosaccharomyces pombe is cleaved at different place than Mgm1p of Schizosaccharomyces cerevisiae
-
-
?
MIC adhesin + H2O

?
-
-
-
-
?
MIC adhesin + H2O
?
-
only TgRMO5 is able to cleave MIC adhesins, it likely provides the key protease activity necessary for invasion
-
-
?
MIC adhesin + H2O
?
-
-
-
-
?
MIC adhesin + H2O
?
-
only TgRMO5 is able to cleave MIC adhesins, it likely provides the key protease activity necessary for invasion
-
-
?
MIC adhesin + H2O
?
-
-
-
-
?
MIC adhesin + H2O
?
-
only TgRMO5 is able to cleave MIC adhesins, it likely provides the key protease activity necessary for invasion
-
-
?
MIC adhesin + H2O
?
-
-
-
-
?
MIC adhesin + H2O
?
-
only TgRMO5 is able to cleave MIC adhesins, it likely provides the key protease activity necessary for invasion
-
-
?
MIC adhesin + H2O
?
-
-
-
-
?
MIC adhesin + H2O
?
-
only TgRMO5 is able to cleave MIC adhesins, it likely provides the key protease activity necessary for invasion
-
-
?
MIC adhesin + H2O
?
-
-
-
-
?
MIC adhesin + H2O
?
-
only TgRMO5 is able to cleave MIC adhesins, it likely provides the key protease activity necessary for invasion
-
-
?
N-acetyl-PEG4-QRKVRMAHIVFSFPC-amide + H2O

N-acetyl-PEG4-QRKVRMA + HIVFSFPC-amide
-
i.e. peptide KSp21
-
-
?
N-acetyl-PEG4-QRKVRMAHIVFSFPC-amide + H2O
N-acetyl-PEG4-QRKVRMA + HIVFSFPC-amide
-
i.e. peptide KSp21
-
-
?
N-acetyl-PEG4-QRKVRMAHIVFSFPC-amide + H2O
N-acetyl-PEG4-QRKVRMA + HIVFSFPC-amide
-
i.e. peptide KSp21
-
-
?
protein Bla-LY2-MBP + H2O

?
-
recombinantly expressed type I model membrane protein substrate having the second transmembrane region of lactose permease LY2 at the extramembrane region in vivo and in vitro at the predicted periplasm-membrane boundary region of LY2, the determinants for proteolysis reside within the LY2 sequence, GlpG cleaves an extramembrane region of the substrate exposed to the periplasm, overview
-
-
?
protein Bla-LY2-MBP + H2O
?
-
recombinantly expressed type I model membrane protein substrate having the second transmembrane region of lactose permease LY2 at the extramembrane region in vivo and in vitro, the determinants for proteolysis reside within the LY2 sequence
-
-
?
protein Gurken + H2O

?
-
-
-
-
?
protein Gurken + H2O
?
-
cleavage by rhomboid 1
-
-
?
protein Gurken + H2O
?
-
cleavage by rhomboid 2
-
-
?
protein Gurken + H2O
?
-
cleavage by rhomboid 3
-
-
?
protein Keren + H2O

?
-
-
-
-
?
protein Keren + H2O
?
-
cleavage by rhomboid 1
-
-
?
protein Keren + H2O
?
-
cleavage by rhomboid 2
-
-
?
protein Keren + H2O
?
-
cleavage by rhomboid 3
-
-
?
protein Spitz + H2O

?
-
rhomboids 1-4 are all dedicated to regulating EGF receptor signalling
-
-
?
protein Spitz + H2O
?
-
when Spitz is cleaved by rhomboids in the endoplasmic reticulum it cannot be secreted. Star regulates Spitz cleavage by rhomboid-1 by transporting Spitz to the Golgi apparatus. Rhomboids 1-4 are all dedicated to regulating EGF receptor signalling
-
-
?
protein Spitz + H2O
?
-
cleavage by rhomboid 1
-
-
?
protein Spitz + H2O
?
-
cleavage by rhomboid 2
-
-
?
protein Spitz + H2O
?
-
cleavage by rhomboid 3
-
-
?
protein Spitz + H2O
?
-
UniProt Accession Code QRHBDL2 cleaves the membrane domain of Drosophila protein Spitz, when the proteins are coexpressed in mammalian cells
-
-
?
Spitz + H2O

?
-
-
-
?
Spitz + H2O
?
-
Rho-1 recognizes a common region of the transmembrane helix substrate that contains small residues (Gly,Ser,Ala)
-
-
?
Spitz + H2O
?
-
rhomboids 1-4 are all dedicated to regulating EGF receptor signalling
-
-
?
Spitz + H2O
?
-
the rhomboid active site in directly cleaves the membrane-anchored TGFalpha-like growth factor Spitz within its transmembarne domain
-
-
?
Spitz + H2O
?
-
cleavage by rhomboid 4
-
-
?
Spitz + H2O
?
-
site-specific cleavage, the substrate Spitz is recognized by a small region of the Spitz transmembrane domain. This substrate motif is necessary and sufficient for cleavage
-
-
?
Spitz + H2O
?
-
the rhomboid active site in directly cleaves the membrane-anchored TGFalpha-like growth factor Spitz within its transmembarne domain
-
-
?
Spitz protein + H2O

?
-
-
-
-
?
Spitz protein + H2O
?
-
-
-
-
?
Spitz-transmembrane domain + H2O

?
-
-
-
-
?
Spitz-transmembrane domain + H2O
?
-
little activity
-
-
?
Spitz-transmembrane domain + H2O
?
little activity
-
-
?
Spitz-transmembrane domain + H2O
?
-
-
-
-
?
Spitz-transmembrane domain + H2O
?
-
-
-
-
?
TatA + H2O

?
-
trans-membrane domain of Providencia stuartii TatA polypeptide segment E2-G98 is engineered into a fusion protein backbone that includes a signal peptide and maltose-binding protein N-terminal to the trans-membrane domain, and a thioredoxin domain and His tag at the C terminus. Substrate is cleaved at the same position by different bacterial rhomboids. Insertion into a fusion protein does not affect cleavage
-
-
?
TatA + H2O
?
-
transmembrane substrate from Providencia stuartii. Binding of TatA occurs with positive cooperativity in an exosite-mediated mode of substrate binding. Exosite formation is dependent on the oligomeric state of rhomboids, and when dimers are dissociated, allosteric substrate activation is not observed
-
-
?
TatA + H2O
?
trans-membrane domain of Providencia stuartii TatA polypeptide segment E2-G98 is engineered into a fusion protein backbone that includes a signal peptide and maltose-binding protein N-terminal to the trans-membrane domain, and a thioredoxin domain and His tag at the C terminus. Substrate is cleaved at the same position by different bacterial rhomboids. Insertion into a fusion protein does not affect cleavage
-
-
?
TatA + H2O
?
-
transmembrane substrate from Providencia stuartii. Binding of TatA occurs with positive cooperativity in an exosite-mediated mode of substrate binding. Exosite formation is dependent on the oligomeric state of rhomboids, and when dimers are dissociated, allosteric substrate activation is not observed
-
-
?
TatA + H2O
?
-
transmembrane substrate from Providencia stuartii. Binding of TatA occurs with positive cooperativity in an exosite-mediated mode of substrate binding. Exosite formation is dependent on the oligomeric state of rhomboids, and when dimers are dissociated, allosteric substrate activation is not observed
-
-
?
TatA + H2O
?
trans-membrane domain of Providencia stuartii TatA polypeptide segment E2-G98 is engineered into a fusion protein backbone that includes a signal peptide and maltose-binding protein N-terminal to the trans-membrane domain, and a thioredoxin domain and His tag at the C terminus. Substrate is cleaved at the same position by different bacterial rhomboids. Insertion into a fusion protein does not affect cleavage
-
-
?
TatA + H2O
?
-
transmembrane substrate from Providencia stuartii. Binding of TatA occurs with positive cooperativity in an exosite-mediated mode of substrate binding. Exosite formation is dependent on the oligomeric state of rhomboids, and when dimers are dissociated, allosteric substrate activation is not observed
-
-
?
TatA + H2O

processed TatA + N-terminal extension peptide
-
-
-
-
?
TatA + H2O
processed TatA + N-terminal extension peptide
-
rhomboid protease AarA mediates quorum-sensing by activating TatA of the twin-arginine translocase, TatA is a component of the twin-arginine translocase, Tat, protein secretion pathway and likely forms a secretion pore, TatA in Providencia stuartii has a short N-terminal extension, which is proteolytically removed by AarA, overview
-
-
?
TatA + H2O
processed TatA + N-terminal extension peptide
-
-
-
-
?
TatA + H2O
processed TatA + N-terminal extension peptide
-
rhomboid protease AarA mediates quorum-sensing by activating TatA of the twin-arginine translocase, TatA is a component of the twin-arginine translocase, Tat, protein secretion pathway and likely forms a secretion pore, TatA in Providencia stuartii has a short N-terminal extension, which is proteolytically removed by AarA, overview
-
-
?
TatA protein + H2O

MESTIATA + AFGSPWQL
-
-
-
-
?
TatA protein + H2O
MESTIATA + AFGSPWQL
-
-
-
-
?
TatA protein + H2O
MESTIATA + AFGSPWQL
-
-
-
-
?
thrombomodulin + H2O

?
-
human thrombomodulin is cleaved by the human, mouse and zebrafish RHBDL2, but not by the Drosophila Rhomboid-1 and the bacterial Aara rhomboid proteases
-
-
?
thrombomodulin + H2O
?
-
human thrombomodulin is cleaved by the human, mouse and zebrafish RHBDL2, but not by the Drosophila Rhomboid-1 and the bacterial Aara rhomboid proteases
-
-
?
thrombomodulin + H2O
?
-
human thrombomodulin is cleaved by the human, mouse and zebrafish RHBDL2, but not by the Drosophila Rhomboid-1 and the bacterial Aara rhomboid proteases
-
-
?
trans-membrane domain + H2O

?
-
trans-membrane domain of Drosophila melanogaster Spitz polypeptide segment G114-L161 is engineered into a fusion protein backbone that includes a signal peptide and maltose-binding protein N-terminal to the trans-membrane domain, and a thioredoxin domain and His tag at the C terminus. Substrate is cleaved at the same position by different bacterial rhomboids. Insertion into a fusion protein does not affect cleavage
-
-
?
trans-membrane domain + H2O
?
trans-membrane domain of Drosophila melanogaster Spitz polypeptide segment G114-L161 is engineered into a fusion protein backbone that includes a signal peptide and maltose-binding protein N-terminal to the trans-membrane domain, and a thioredoxin domain and His tag at the C terminus. Substrate is cleaved at the same position by different bacterial rhomboids. Insertion into a fusion protein does not affect cleavage
-
-
?
trans-membrane domain + H2O
?
trans-membrane domain of Drosophila melanogaster Spitz polypeptide segment G114-L161 is engineered into a fusion protein backbone that includes a signal peptide and maltose-binding protein N-terminal to the trans-membrane domain, and a thioredoxin domain and His tag at the C terminus. Substrate is cleaved at the same position by different bacterial rhomboids. Insertion into a fusion protein does not affect cleavage
-
-
?
trans-membrane domain Gurken + H2O

?
-
trans-membrane domain of Drosophila melanogaster Gurken polypeptide segment A223-R271 is engineered into a fusion protein backbone that includes a signal peptide and maltose-binding protein N-terminal to the trans-membrane domain, and a thioredoxin domain and His tag at the C terminus. Substrate is cleaved at the same position by different bacterial rhomboids. Insertion into a fusion protein does not affect cleavage
-
-
?
trans-membrane domain Gurken + H2O
?
trans-membrane domain of Drosophila melanogaster Gurken polypeptide segment A223-R271 is engineered into a fusion protein backbone that includes a signal peptide and maltose-binding protein N-terminal to the trans-membrane domain, and a thioredoxin domain and His tag at the C terminus. Substrate is cleaved at the same position by different bacterial rhomboids. Insertion into a fusion protein does not affect cleavage
-
-
?
trans-membrane domain Gurken + H2O
?
trans-membrane domain of Drosophila melanogaster Gurken polypeptide segment A223-R271 is engineered into a fusion protein backbone that includes a signal peptide and maltose-binding protein N-terminal to the trans-membrane domain, and a thioredoxin domain and His tag at the C terminus. Substrate is cleaved at the same position by different bacterial rhomboids. Insertion into a fusion protein does not affect cleavage
-
-
?
TRAP protein + H2O

?
transmembrane protein with extracellular adhesive domains and a cytoplasmic tail linked to the actomyosin motor. Mutations in the rhomboid cleavage site impair TRAP processing and lead to its accumulation on the sporozoite surface. A TRAP mutant in which both the rhomboid-cleavage site and the alternate cleavage site are altered is non-motile and non-infectious
-
-
?
TRAP protein + H2O
?
transmembrane protein with extracellular adhesive domains and a cytoplasmic tail linked to the actomyosin motor. Mutations in the rhomboid cleavage site impair TRAP processing and lead to its accumulation on the sporozoite surface. A TRAP mutant in which both the rhomboid-cleavage site and the alternate cleavage site are altered is non-motile and non-infectious
-
-
?
additional information

?
-
-
rhomboid proteases are part of the regulated intramembrane proteolysis mechanism for controlling processes such as development, stress response, lipid metabolism and mitochondrial membrane remodeling
-
-
-
additional information
?
-
-
site-specific serine protease, that cleaves substrates within the vicinity of a transmembrane domain, the cleavage product is then released from the membrane and the other portion is secreted, the enzyme interacts with the plastid translocon component Tic40, overview
-
-
-
additional information
?
-
-
no cleavage of Gurken-transmembrane domain
-
-
-
additional information
?
-
-
the enzyme is important in cell signaling, mechanism, overview
-
-
-
additional information
?
-
the enzyme is involved in regulation of growth factor signaling, mitochondrial fusion, and parasite invasion
-
-
-
additional information
?
-
-
based on trans-membrane domain of Providencia stuartii TatA as a model substrate a primary recognition motif is identified by a series of deletion analysis. Three positions are particularly sensitive to mutations: P1, P4 and P2'. Whereas P1 tolerates only amino acids with a small side chain, P4 requires large and hydrophobic residues, and P2' prefers hydrophobic side chains irrespective of their size. All other positions between P5 and P2' can tolerate a variety of amino acids, although tryptophan, proline, and aspartate are deleterious in most of them. This recognition motif is functionally conserved in multiple substrates
-
-
-
additional information
?
-
-
regulation, overview
-
-
-
additional information
?
-
-
Rhomboid is the signal-generating component of epidermal growth factor receptor signaling during development, a metazoan developmental regulator, intramembrane proteolysis is a widespread regulatory mechanism, overview, Rhomboid-3 is important in eye development
-
-
-
additional information
?
-
-
the enzyme is involved in regulation of growth factor signaling, and mitochondrial fusion
-
-
-
additional information
?
-
-
Rhomboid cleaves both type I and type II transmembrane proteins
-
-
-
additional information
?
-
-
structure-function relationship, substrate entry, Rhomboid active-site topology, overview
-
-
-
additional information
?
-
-
no cleavage of EGFR, Delta, TGN38 or TGFalpha
-
-
-
additional information
?
-
-
no cleavage of Gurken-transmembrane domain
-
-
-
additional information
?
-
-
regulation, overview
-
-
-
additional information
?
-
intramembrane proteolysis is a core regulatory mechanism of cells that raises a biochemical paradox of how hydrolysis of peptide bonds is accomplished within the normally hydrophobic environment of the membrane
-
-
-
additional information
?
-
-
intramembrane proteolysis regulates diverse biological processes
-
-
-
additional information
?
-
-
the enzyme is important in cell signaling, mechanism, overview
-
-
-
additional information
?
-
the enzyme is involved in regulation of growth factor signaling, mitochondrial fusion, and parasite invasion
-
-
-
additional information
?
-
-
structural analysis of the enzyme reveals a gating mechanism for substrate entry, cleavage of substrate peptide bonds within the membrane bilayer, the catalytic Ser201 is located at the N terminus of helix alpha4 approximately 10 A below the membrane surface, structure-function realationship, overview
-
-
-
additional information
?
-
-
structure-function relationship, substrate entry, overview
-
-
-
additional information
?
-
-
the enzyme cleave the transmembrane domain of other membrane proteins, membrane topology of a rhomboid protease and its substrate, overview
-
-
-
additional information
?
-
-
the intramembrane enzyme possesses a intramembraneously located active site, which is accessible to water and hydrolyses an extramembrane peptide bond of substrates, membrane-embedded polypeptide segments of substrates enter at lateral entrance into the enzymes active site
-
-
-
additional information
?
-
-
to derive a dynamic view of GlpG in a fluid lipid bilayer, the lipid interactions of GlpG embedded in 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphatidylcholine (POPE) and 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphatidylethanolamine (POPC) lipid bilayers is examined. The irregular shape and small hydrophobic thickness of the protein cause significant bilayer deformations that may be important for substrate entry into the active site. Hydrogen-bond interactions with lipids are paramount in protein orientation and dynamics. Mutations in the unusual L1 loop cause changes in protein dynamics and protein orientation that are relayed to the His-Ser catalytic dyad. Similarly, mutations in TM5 change the dynamics and structure of the L1 loop
-
-
-
additional information
?
-
-
an artificial fusion protein bearing the sequence around the second transmembrane domain of LacY is cleavable by Escherichia coli GlpG in intact bacterial cells (LacY itself is not a substrate for rhomboid). A Ser-Asp bond is cleaved
-
-
-
additional information
?
-
-
removal of the cytoplasmic domain does not alter the catalytic parameters for detergent-solubilized rhomboid for both substrates BODIPY FL casein and protein TatA
-
-
-
additional information
?
-
-
rhomboids may have two different mechanisms for substrate recognition. The transmembrane substrate is recognized on the hydrophobic belt of the enzyme by the exosite, which facilitates the substrate entry laterally into the active site. Soluble substrates, such as FL-casein, do not require initial exosite binding and approach the active site from the soluble face of the enzyme via the opening of loop 5
-
-
-
additional information
?
-
-
GlpG prefers residues with a small side chain and a negative charge at the P1 and P1' sites, respectively, cleavage sites of model substrates and structure function relationship, overview
-
-
-
additional information
?
-
based on trans-membrane domain of Providencia stuartii TatA as a model substrate a primary recognition motif is identified by a series of deletion analysis. Three positions are particularly sensitive to mutations: P1, P4 and P2'. Whereas P1 tolerates only amino acids with a small side chain, P4 requires large and hydrophobic residues, and P2' prefers hydrophobic side chains irrespective of their size. All other positions between P5 and P2' can tolerate a variety of amino acids, although tryptophan, proline, and aspartate are deleterious in most of them. This recognition motif is functionally conserved in multiple substrates
-
-
-
additional information
?
-
regulation, overview
-
-
-
additional information
?
-
structure-function relationship, substrate entry, overview
-
-
-
additional information
?
-
-
rhomboids may have two different mechanisms for substrate recognition. The transmembrane substrate is recognized on the hydrophobic belt of the enzyme by the exosite, which facilitates the substrate entry laterally into the active site. Soluble substrates, such as FL-casein, do not require initial exosite binding and approach the active site from the soluble face of the enzyme via the opening of loop 5
-
-
-
additional information
?
-
-
rhomboids may have two different mechanisms for substrate recognition. The transmembrane substrate is recognized on the hydrophobic belt of the enzyme by the exosite, which facilitates the substrate entry laterally into the active site. Soluble substrates, such as FL-casein, do not require initial exosite binding and approach the active site from the soluble face of the enzyme via the opening of loop 5
-
-
-
additional information
?
-
-
regulated intramembrane proteolysis in which the putative signaling moiety is part of the intramembrane-cleaving protease itself. Cytosolic N-terminal domain of PARL is cleaved at positions 5253 (alpha-site) and 7778 (beta-site). Whereas alpha-cleavage is constitutive and removes the mitochondrial targeting sequence, beta-cleavage appears to be developmentally controlled and dependent on PARL intramembrane-cleaving protease activity supplied in trans. The beta-cleavage of PARL liberates Pbeta, a nuclear targeted peptide whose sequence is conserved only in mammals. Thus, in addition to its evolutionarily conserved function in regulating mitochondrial dynamics, PARL might mediate a mammalian-specific, developmentally regulated mitochondria-to-nuclei signaling through regulated proteolysis of its N-terminus and release of the Pbeta peptide
-
-
-
additional information
?
-
-
membrane domains of several mammalian EGF-faily proteins are not cleaved by RHBDL2, suggesting that the endogenous targets of the human protease are not EGF-related factors. Amino acid sequence at the luminal face of the membrane domain of a substrate protein determines whether it is cleaved by RHBDL2
-
-
-
additional information
?
-
-
the enzyme is important in cell signaling, mechanism, overview
-
-
-
additional information
?
-
-
the enzyme is involved in regulation of growth factor signaling, and mitochondrial fusion
-
-
-
additional information
?
-
-
PARL interacts with Alzheimers presenilin protein in vitro
-
-
-
additional information
?
-
-
rhomboid protease RHBDL2 does not cleave transforming growth factor alpha, epiregulin, betacellulin, amphiregulin, heparin binding-epidermal growth factor, vaccinia virus growth factor, transmembrane protein with EGF-like and two follistatin-like domains 2, calnexin, TACE, site-1 protease, neu differentiation factor beta4alpha (Nrg1 isoform), rat glial cell growth factor (Nrg1 isoform), and Nrg4
-
-
-
additional information
?
-
positively charged transmembrane residues promote isoform RHBDL4-catalyzed cleavage
-
-
-
additional information
?
-
-
the enzyme is involved in regulation of growth factor signaling, and mitochondrial fusion
-
-
-
additional information
?
-
-
rhomboid proteases are part of the regulated intramembrane proteolysis mechanism for controlling processes such as development, stress response, lipid metabolism and mitochondrial membrane remodeling
-
-
-
additional information
?
-
-
site-specific serine protease, that cleaves substrates within the vicinity of a transmembrane domain, the cleavage product is then released from the membrane and the other portion is secreted, the enzyme interacts with the plastid translocon component Tic40, overview
-
-
-
additional information
?
-
a protease that cleaves the transmembrane regions of proteins involved in parasite invasion
-
-
-
additional information
?
-
-
a protease that cleaves the transmembrane regions of proteins involved in parasite invasion
-
-
-
additional information
?
-
-
the enzyme is involved in regulation of growth factor signaling, mitochondrial fusion, and parasite invasion
-
-
-
additional information
?
-
-
the two rhomboid proteases ROM1 and ROM4 preferentially cleave different adhesins implicated in all invasive stages of malaria, invasion of host cells by the malaria pathogen relies on parasite transmembrane adhesins that engage host-cell receptors, adhesins must be released by cleavage before the parasite can enter the cell, overview, swapping transmembrane regions between substrates BAEBL and AMA1 switches the relative preferences of ROMs 1 and 4 for these two substrates, no cleavage of adhesin PTRAMP
-
-
-
additional information
?
-
-
ROMs 1 and 4 display distinct substrate specificity, overview
-
-
-
additional information
?
-
-
the enzyme is important in cell signaling, mechanism, overview
-
-
-
additional information
?
-
the enzyme is involved in regulation of growth factor signaling, mitochondrial fusion, and parasite invasion
-
-
-
additional information
?
-
based on trans-membrane domain of Providencia stuartii TatA as a model substrate a primary recognition motif is identified by a series of deletion analysis. Three positions are particularly sensitive to mutations: P1, P4 and P2'. Whereas P1 tolerates only amino acids with a small side chain, P4 requires large and hydrophobic residues, and P2' prefers hydrophobic side chains irrespective of their size. All other positions between P5 and P2' can tolerate a variety of amino acids, although tryptophan, proline, and aspartate are deleterious in most of them. This recognition motif is functionally conserved in multiple substrates
-
-
-
additional information
?
-
-
rhomboids may have two different mechanisms for substrate recognition. The transmembrane substrate is recognized on the hydrophobic belt of the enzyme by the exosite, which facilitates the substrate entry laterally into the active site. Soluble substrates, such as FL-casein, do not require initial exosite binding and approach the active site from the soluble face of the enzyme via the opening of loop 5
-
-
-
additional information
?
-
-
Rhomboids are ubiquitous integral membrane proteases that release cellular signals from membrane-bound substrates through a general signal transduction mechanism known as regulated intramembrane proteolysis
-
-
-
additional information
?
-
the enzyme is involved in regulation of growth factor signaling, mitochondrial fusion, and parasite invasion
-
-
-
additional information
?
-
-
the N-terminal cytosolic domain NRho plays a role in scissile peptide bond selectivity by optimally positioning the Rhomboid active site relative to the membrane plane
-
-
-
additional information
?
-
-
rhomboid proteases are part of the regulated intramembrane proteolysis mechanism for controlling processes such as development, stress response, lipid metabolism and mitochondrial membrane remodeling
-
-
-
additional information
?
-
-
site-specific serine protease, that cleaves substrates within the vicinity of a transmembrane domain, the cleavage product is then released from the membrane and the other portion is secreted, the enzyme interacts with the plastid translocon component Tic40, overview
-
-
-
additional information
?
-
-
intramolecular proteolysis by rhomboids controls cellular processes other than signalling
-
-
-
additional information
?
-
-
rhomboid protease Pcp1 catalyzes the second processing step of cytochrome c peroxidase, yielding the mature cytochrome c peroxidase protein
-
-
-
additional information
?
-
-
the enzyme is important in cell signaling, mechanism, overview
-
-
-
additional information
?
-
-
the enzyme is involved in regulation of growth factor signaling, and mitochondrial fusion
-
-
-
additional information
?
-
-
no cleavage of Spitz anf Gurken
-
-
-
additional information
?
-
ROM1 does not play a critical role in cell invasion, ROM1-deficient parasites are outcompeted by wild-type Toxoplasma gondii, the ROM1-deficient parasites show only modest decrease in invasion but replicate more slowly than wild-type cells, ROM1 is required for efficient intracellular growth of the parasite, overview
-
-
-
additional information
?
-
-
the enzyme is involved in regulation of growth factor signaling, mitochondrial fusion, and parasite invasion
-
-
-
additional information
?
-
-
the enzyme proteolytically cleaves adhesin-receptor complexes during parasite invasion, overview, the enzyme is important in cell sigaling, mechanism, overview
-
-
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
adhesin BAEBL + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin CTRP + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin EBA-175 + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin JESEBL + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin MAEBL + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin MIC2 + H2O
?
Q695T8
-
-
-
?
adhesin MTRAP + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin PFF0800c + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin Rh1 + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin Rh24 + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin Rh2a + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin Rh2b + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
adhesin TRAP + H2O
?
-
substrate of ROM1 and ROM4
-
-
?
apical membrane antigen 1 + H2O
?
-
i.e. AMA1, substrate only of ROM1
-
-
?
chaperone Star + H2O
?
-
cleavage of Star within its transmembrane domain both in cell culture and in flies, the enzyme is involved in regulation of levels of Spitz, the major Drosophila EGF receptor ligand, mechanism for modulating the activity of Star, thereby influencing the levels of active Spitz ligand, intracellular trafficking of Spitz isimpaired by Rhomboid-dependent cleavage of Star, overview
-
-
?
cytochrome c peroxidase + H2O
processed cytochrome c peroxidase + targeting sequence peptide
-
cleaving the targeting sequence of cytochrome c peroxidase, Pcp1
-
-
?
ephrin B3 + H2O
?
-
RHBDL-2 mediated proteolytic processing may regulate intercellular interactions between ephrinB3 and eph receptors
-
-
?
epidermal growth factor + H2O
?
-
efficient and specific substrate for rhomboid protease RHBDL2
-
-
?
growth factor Spitz + H2O
?
growth-factor gurken + H2O
?
-
-
-
-
?
growth-factor spitz + H2O
?
-
-
-
-
?
Gurken protein + H2O
?
-
-
-
-
?
Gurken protein + H2O
PQRKVRMA + HIVFSFFV
Gurken-derived peptide + H2O
?
Keren protein + H2O
?
-
-
-
-
?
l-Mgm1 + H2O
s-Mgm1 + N-terminal putative transmembrane segment
-
rhomboid-type protease Pcp1 is essential for wild type mitochondrial morphology. The processing of the large isoform l-Mgm1 by rhomboid-type protease Pcp1 to s-Mgm1, and the presence of both isoforms of Mgm1 appears to be crucial for wild-type mitochondrial morphology and maintenance of mitochondrial DNA
-
-
?
LacYTM2 protein + H2O
DINHISKS + DTGIIFAA
large isoform of Mgm1 + H2O
short isoform of Mgm1 + ?
-
the enzyme is involved in the pathway of Mgm1 biogenesis. A strong shift in the ratio between both isoform of Mgm1 is sufficient to alter mitochondrial morphology
-
-
?
lectin + H2O
?
-
EhROM1 is able to cleave cell surface lectin
-
-
?
Mgm1 + H2O
?
-
cleaving the long isoform of Mgm1 to produce the short one
-
-
?
protein Gurken + H2O
?
-
-
-
-
?
protein Keren + H2O
?
-
-
-
-
?
TatA + H2O
processed TatA + N-terminal extension peptide
TatA protein + H2O
?
-
-
-
-
?
TatA protein + H2O
MESTIATA + AFGSPWQL
thrombomodulin + H2O
soluble thrombomodulin + ?
-
-
-
-
?
Tic40 + H2O
?
-
i.e. the chloroplast inner envelope translocon component of 40 kDa
-
-
?
additional information
?
-
growth factor Spitz + H2O

?
-
-
-
-
?
growth factor Spitz + H2O
?
-
Rhomboid-1
-
-
?
growth factor Spitz + H2O
?
-
Rhomboid-1 is important in extracellular signal production, overview
-
-
?
Gurken protein + H2O

PQRKVRMA + HIVFSFFV
-
-
-
-
?
Gurken protein + H2O
PQRKVRMA + HIVFSFFV
-
-
-
-
?
Gurken protein + H2O
PQRKVRMA + HIVFSFFV
-
-
-
-
?
Gurken-derived peptide + H2O

?
-
-
-
-
?
Gurken-derived peptide + H2O
?
-
-
-
-
?
LacYTM2 protein + H2O

DINHISKS + DTGIIFAA
-
-
-
-
?
LacYTM2 protein + H2O
DINHISKS + DTGIIFAA
-
-
-
-
?
LacYTM2 protein + H2O
DINHISKS + DTGIIFAA
-
-
-
-
?
MIC adhesin + H2O

?
-
only TgRMO5 is able to cleave MIC adhesins, it likely provides the key protease activity necessary for invasion
-
-
?
MIC adhesin + H2O
?
-
only TgRMO5 is able to cleave MIC adhesins, it likely provides the key protease activity necessary for invasion
-
-
?
MIC adhesin + H2O
?
-
only TgRMO5 is able to cleave MIC adhesins, it likely provides the key protease activity necessary for invasion
-
-
?
MIC adhesin + H2O
?
-
only TgRMO5 is able to cleave MIC adhesins, it likely provides the key protease activity necessary for invasion
-
-
?
MIC adhesin + H2O
?
-
only TgRMO5 is able to cleave MIC adhesins, it likely provides the key protease activity necessary for invasion
-
-
?
MIC adhesin + H2O
?
-
only TgRMO5 is able to cleave MIC adhesins, it likely provides the key protease activity necessary for invasion
-
-
?
protein Spitz + H2O

?
-
rhomboids 1-4 are all dedicated to regulating EGF receptor signalling
-
-
?
protein Spitz + H2O
?
-
when Spitz is cleaved by rhomboids in the endoplasmic reticulum it cannot be secreted. Star regulates Spitz cleavage by rhomboid-1 by transporting Spitz to the Golgi apparatus. Rhomboids 1-4 are all dedicated to regulating EGF receptor signalling
-
-
?
Spitz + H2O

?
-
rhomboids 1-4 are all dedicated to regulating EGF receptor signalling
-
-
?
Spitz + H2O
?
-
the rhomboid active site in directly cleaves the membrane-anchored TGFalpha-like growth factor Spitz within its transmembarne domain
-
-
?
Spitz + H2O
?
-
the rhomboid active site in directly cleaves the membrane-anchored TGFalpha-like growth factor Spitz within its transmembarne domain
-
-
?
Spitz protein + H2O

?
-
-
-
-
?
Spitz protein + H2O
?
-
-
-
-
?
TatA + H2O

processed TatA + N-terminal extension peptide
-
rhomboid protease AarA mediates quorum-sensing by activating TatA of the twin-arginine translocase, TatA is a component of the twin-arginine translocase, Tat, protein secretion pathway and likely forms a secretion pore, TatA in Providencia stuartii has a short N-terminal extension, which is proteolytically removed by AarA, overview
-
-
?
TatA + H2O
processed TatA + N-terminal extension peptide
-
rhomboid protease AarA mediates quorum-sensing by activating TatA of the twin-arginine translocase, TatA is a component of the twin-arginine translocase, Tat, protein secretion pathway and likely forms a secretion pore, TatA in Providencia stuartii has a short N-terminal extension, which is proteolytically removed by AarA, overview
-
-
?
TatA protein + H2O

MESTIATA + AFGSPWQL
-
-
-
-
?
TatA protein + H2O
MESTIATA + AFGSPWQL
-
-
-
-
?
TatA protein + H2O
MESTIATA + AFGSPWQL
-
-
-
-
?
additional information

?
-
-
rhomboid proteases are part of the regulated intramembrane proteolysis mechanism for controlling processes such as development, stress response, lipid metabolism and mitochondrial membrane remodeling
-
-
-
additional information
?
-
-
the enzyme is important in cell signaling, mechanism, overview
-
-
-
additional information
?
-
P54493
the enzyme is involved in regulation of growth factor signaling, mitochondrial fusion, and parasite invasion
-
-
-
additional information
?
-
-
regulation, overview
-
-
-
additional information
?
-
-
Rhomboid is the signal-generating component of epidermal growth factor receptor signaling during development, a metazoan developmental regulator, intramembrane proteolysis is a widespread regulatory mechanism, overview, Rhomboid-3 is important in eye development
-
-
-
additional information
?
-
-
the enzyme is involved in regulation of growth factor signaling, and mitochondrial fusion
-
-
-
additional information
?
-
-
regulation, overview
-
-
-
additional information
?
-
P09391
intramembrane proteolysis is a core regulatory mechanism of cells that raises a biochemical paradox of how hydrolysis of peptide bonds is accomplished within the normally hydrophobic environment of the membrane
-
-
-
additional information
?
-
-
intramembrane proteolysis regulates diverse biological processes
-
-
-
additional information
?
-
-
the enzyme is important in cell signaling, mechanism, overview
-
-
-
additional information
?
-
P09391
the enzyme is involved in regulation of growth factor signaling, mitochondrial fusion, and parasite invasion
-
-
-
additional information
?
-
P44783
regulation, overview
-
-
-
additional information
?
-
-
regulated intramembrane proteolysis in which the putative signaling moiety is part of the intramembrane-cleaving protease itself. Cytosolic N-terminal domain of PARL is cleaved at positions 5253 (alpha-site) and 7778 (beta-site). Whereas alpha-cleavage is constitutive and removes the mitochondrial targeting sequence, beta-cleavage appears to be developmentally controlled and dependent on PARL intramembrane-cleaving protease activity supplied in trans. The beta-cleavage of PARL liberates Pbeta, a nuclear targeted peptide whose sequence is conserved only in mammals. Thus, in addition to its evolutionarily conserved function in regulating mitochondrial dynamics, PARL might mediate a mammalian-specific, developmentally regulated mitochondria-to-nuclei signaling through regulated proteolysis of its N-terminus and release of the Pbeta peptide
-
-
-
additional information
?
-
-
the enzyme is important in cell signaling, mechanism, overview
-
-
-
additional information
?
-
-
the enzyme is involved in regulation of growth factor signaling, and mitochondrial fusion
-
-
-
additional information
?
-
-
rhomboid protease RHBDL2 does not cleave transforming growth factor alpha, epiregulin, betacellulin, amphiregulin, heparin binding-epidermal growth factor, vaccinia virus growth factor, transmembrane protein with EGF-like and two follistatin-like domains 2, calnexin, TACE, site-1 protease, neu differentiation factor beta4alpha (Nrg1 isoform), rat glial cell growth factor (Nrg1 isoform), and Nrg4
-
-
-
additional information
?
-
-
the enzyme is involved in regulation of growth factor signaling, and mitochondrial fusion
-
-
-
additional information
?
-
-
rhomboid proteases are part of the regulated intramembrane proteolysis mechanism for controlling processes such as development, stress response, lipid metabolism and mitochondrial membrane remodeling
-
-
-
additional information
?
-
A8IWX2
a protease that cleaves the transmembrane regions of proteins involved in parasite invasion
-
-
-
additional information
?
-
-
a protease that cleaves the transmembrane regions of proteins involved in parasite invasion
-
-
-
additional information
?
-
-
the enzyme is involved in regulation of growth factor signaling, mitochondrial fusion, and parasite invasion
-
-
-
additional information
?
-
-
the two rhomboid proteases ROM1 and ROM4 preferentially cleave different adhesins implicated in all invasive stages of malaria, invasion of host cells by the malaria pathogen relies on parasite transmembrane adhesins that engage host-cell receptors, adhesins must be released by cleavage before the parasite can enter the cell, overview, swapping transmembrane regions between substrates BAEBL and AMA1 switches the relative preferences of ROMs 1 and 4 for these two substrates, no cleavage of adhesin PTRAMP
-
-
-
additional information
?
-
-
the enzyme is important in cell signaling, mechanism, overview
-
-
-
additional information
?
-
P46116
the enzyme is involved in regulation of growth factor signaling, mitochondrial fusion, and parasite invasion
-
-
-
additional information
?
-
-
Rhomboids are ubiquitous integral membrane proteases that release cellular signals from membrane-bound substrates through a general signal transduction mechanism known as regulated intramembrane proteolysis
-
-
-
additional information
?
-
Q9HZC2
the enzyme is involved in regulation of growth factor signaling, mitochondrial fusion, and parasite invasion
-
-
-
additional information
?
-
-
rhomboid proteases are part of the regulated intramembrane proteolysis mechanism for controlling processes such as development, stress response, lipid metabolism and mitochondrial membrane remodeling
-
-
-
additional information
?
-
-
intramolecular proteolysis by rhomboids controls cellular processes other than signalling
-
-
-
additional information
?
-
-
rhomboid protease Pcp1 catalyzes the second processing step of cytochrome c peroxidase, yielding the mature cytochrome c peroxidase protein
-
-
-
additional information
?
-
-
the enzyme is important in cell signaling, mechanism, overview
-
-
-
additional information
?
-
-
the enzyme is involved in regulation of growth factor signaling, and mitochondrial fusion
-
-
-
additional information
?
-
Q695U0
ROM1 does not play a critical role in cell invasion, ROM1-deficient parasites are outcompeted by wild-type Toxoplasma gondii, the ROM1-deficient parasites show only modest decrease in invasion but replicate more slowly than wild-type cells, ROM1 is required for efficient intracellular growth of the parasite, overview
-
-
-
additional information
?
-
-
the enzyme is involved in regulation of growth factor signaling, mitochondrial fusion, and parasite invasion
-
-
-
additional information
?
-
-
the enzyme proteolytically cleaves adhesin-receptor complexes during parasite invasion, overview, the enzyme is important in cell sigaling, mechanism, overview
-
-
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
(3S,4S)-1-[(4-chlorophenyl)sulfonyl]-3-methyl-4-phenylazetidin-2-one
(3S,4S)-3-methyl-1-[(4-methylphenyl)sulfonyl]-4-phenylazetidin-2-one
-
-
1,2-dihexanoyl-sn-glycero-3-phosphocholine
-
1,2-dimyristoyl-sn-glycero-3-phosphocholine additionally added, paGlpG purified in detergent causes 37% reduction in activity
1,2-dimyristoyl-sn-glycero-3-phosphocholine
-
paGlpG purified in detergent causes 5% reduction in activity
1-(2,3-dihydro-4H-1,4-benzoxazin-4-yl)-3,3,3-trifluoro-2-(trifluoromethyl)propan-1-one
1-(biphenyl-3-ylsulfonyl)-4-phenylazetidin-2-one
1-(biphenyl-4-ylsulfonyl)-4-phenylazetidin-2-one
1-myristoyl-sn-glycero-3-phosphocholine
-
paGlpG purified in detergent causes 10% reduction in activity
1-palmitoyl-sn-glycero-3-phospho-rac-(1-glycerol)
-
paGlpG purified in detergent causes 20% reduction in activity
1-[(3'-methylbiphenyl-4-yl)sulfonyl]-4-phenylazetidin-2-one
1-[(3-bromophenyl)sulfonyl]-4-phenylazetidin-2-one
1-[(3-chlorophenyl)sulfonyl]-4-(2-phenylethyl)azetidin-2-one
1-[(3-chlorophenyl)sulfonyl]-4-(propan-2-yl)azetidin-2-one
1-[(4'-chlorobiphenyl-4-yl)sulfonyl]-4-phenylazetidin-2-one
1-[(4-bromophenyl)sulfonyl]-4-phenylazetidin-2-one
1-[(4-chlorophenyl)sulfonyl]-3-methylazetidin-2-one
1-[(4-methylphenyl)sulfonyl]-4-phenylazetidin-2-one
2-methylpropyl 2-oxo-4-phenylazetidine-1-carboxylate
-
beta-lactam inhibitor, forms a single bond to the catalytic serine and the carbonyl oxygen of the inhibitor faces away from the oxyanion hole. The hydrophobic N-substituent of the inhibitor points into a cavity within the enzyme, providing a structural explanation for the specificity of beta-lactams on rhomboid proteases. This same cavity probably represents the S2' substrate binding site
3,3,3-trifluoro-N-[(5-methyl-2-phenyl-2H-1,2,3-triazol-4-yl)methyl]-2-(trifluoromethyl)propanamide
3,3,3-trifluoro-N-[2-(propan-2-yloxy)phenyl]-2-(trifluoromethyl)propanamide
3-methyl-1-[(4-methylphenyl)sulfonyl]-4-phenylazetidin-2-one
-
-
3-[(3-cholamidopropyl)-dimethylammonio]-1-propansulfonate
-
1,2-dimyristoyl-sn-glycero-3-phosphocholine additionally added, paGlpG purified in detergent causes 37% reduction in activity
4-(2-chlorophenyl)-1-[(3-chlorophenyl)sulfonyl]azetidin-2-one
4-(3-bromophenyl)-1-[(3-chlorophenyl)sulfonyl]azetidin-2-one
4-[(3-methyl-2-oxoazetidin-1-yl)sulfonyl]benzonitrile
7-amino-3-butoxy-4-chloro-1H-isochromen-1-one
-
-
7-amino-4-chloro-3-(2-phenylethoxy)-1H-isochromen-1-one
-
-
7-amino-4-chloro-3-methoxyisocoumarin
-
-
7-amino-4-chloro-3-[(5-phenylpentyl)oxy]-1H-isochromen-1-one
-
-
acetyl-L-Ile-L-Ala-L-Thr-L-Ala-chloromethylketone
-
inhibitor derived from the natural rhomboid substrate TatA from bacterium Providencia stuartii, binds in a substrate-like manner
acetyl-L-Phe-L-Ala-L-Thr-L-Ala-chloromethylketone
-
inhibitor derived from the natural rhomboid substrate TatA from bacterium Providencia stuartii, binds in a substrate-like manner
benzyl (2S)-1-[(4-methylphenyl)sulfonyl]-4-oxoazetidine-2-carboxylate
cyclopentyl 2-oxo-4-phenylazetidine-1-carboxylate
-
beta-lactam inhibitor, forms a single bond to the catalytic serine and the carbonyl oxygen of the inhibitor faces away from the oxyanion hole. The hydrophobic N-substituent of the inhibitor points into a cavity within the enzyme, providing a structural explanation for the specificity of beta-lactams on rhomboid proteases. This same cavity probably represents the S2' substrate binding site
diisopropyl fluorophosphonate
-
irreversible inhibition; mechansim-based inhibitor
dodecyl maltoside
-
paGlpG purified in detergent causes 77% reduction in activity
N-(2,6-dimethylphenyl)-3,3,3-trifluoro-2-(trifluoromethyl)propanamide
n-nonyl-beta-D-glucoside
-
paGlpG purified in detergent causes 45% reduction in activity
N-[2-(cyclopentyloxy)phenyl]-3,3,3-trifluoro-2-(trifluoromethyl)propanamide
N-[2-(cyclopropylmethoxy)phenyl]-3,3,3-trifluoro-2-(trifluoromethyl)propanamide
phenyl 2-oxo-4-phenylazetidine-1-carboxylate
tert-butyl 2-[[3,3,3-trifluoro-2-(trifluoromethyl)propanoyl]amino]benzoate
(3S,4S)-1-[(4-chlorophenyl)sulfonyl]-3-methyl-4-phenylazetidin-2-one

-
-
(3S,4S)-1-[(4-chlorophenyl)sulfonyl]-3-methyl-4-phenylazetidin-2-one
-
-
1-(2,3-dihydro-4H-1,4-benzoxazin-4-yl)-3,3,3-trifluoro-2-(trifluoromethyl)propan-1-one

-
-
1-(2,3-dihydro-4H-1,4-benzoxazin-4-yl)-3,3,3-trifluoro-2-(trifluoromethyl)propan-1-one
-
-
1-(biphenyl-3-ylsulfonyl)-4-phenylazetidin-2-one

-
-
1-(biphenyl-3-ylsulfonyl)-4-phenylazetidin-2-one
-
-
1-(biphenyl-4-ylsulfonyl)-4-phenylazetidin-2-one

-
-
1-(biphenyl-4-ylsulfonyl)-4-phenylazetidin-2-one
-
-
1-[(3'-methylbiphenyl-4-yl)sulfonyl]-4-phenylazetidin-2-one

-
-
1-[(3'-methylbiphenyl-4-yl)sulfonyl]-4-phenylazetidin-2-one
-
-
1-[(3-bromophenyl)sulfonyl]-4-phenylazetidin-2-one

-
-
1-[(3-bromophenyl)sulfonyl]-4-phenylazetidin-2-one
-
-
1-[(3-chlorophenyl)sulfonyl]-4-(2-phenylethyl)azetidin-2-one

-
-
1-[(3-chlorophenyl)sulfonyl]-4-(2-phenylethyl)azetidin-2-one
-
-
1-[(3-chlorophenyl)sulfonyl]-4-(propan-2-yl)azetidin-2-one

-
-
1-[(3-chlorophenyl)sulfonyl]-4-(propan-2-yl)azetidin-2-one
-
-
1-[(4'-chlorobiphenyl-4-yl)sulfonyl]-4-phenylazetidin-2-one

-
-
1-[(4'-chlorobiphenyl-4-yl)sulfonyl]-4-phenylazetidin-2-one
-
-
1-[(4-bromophenyl)sulfonyl]-4-phenylazetidin-2-one

-
-
1-[(4-bromophenyl)sulfonyl]-4-phenylazetidin-2-one
-
-
1-[(4-chlorophenyl)sulfonyl]-3-methylazetidin-2-one

-
-
1-[(4-chlorophenyl)sulfonyl]-3-methylazetidin-2-one
-
-
1-[(4-methylphenyl)sulfonyl]-4-phenylazetidin-2-one

-
-
1-[(4-methylphenyl)sulfonyl]-4-phenylazetidin-2-one
-
-
3,3,3-trifluoro-N-[(5-methyl-2-phenyl-2H-1,2,3-triazol-4-yl)methyl]-2-(trifluoromethyl)propanamide

-
-
3,3,3-trifluoro-N-[(5-methyl-2-phenyl-2H-1,2,3-triazol-4-yl)methyl]-2-(trifluoromethyl)propanamide
-
-
3,3,3-trifluoro-N-[2-(propan-2-yloxy)phenyl]-2-(trifluoromethyl)propanamide

-
-
3,3,3-trifluoro-N-[2-(propan-2-yloxy)phenyl]-2-(trifluoromethyl)propanamide
-
-
3,4-dichloroisocoumarin

-
-
3,4-dichloroisocoumarin
-
; mechanism-based inhibitor
3,4-dichloroisocoumarin
-
-
4-(2-chlorophenyl)-1-[(3-chlorophenyl)sulfonyl]azetidin-2-one

-
-
4-(2-chlorophenyl)-1-[(3-chlorophenyl)sulfonyl]azetidin-2-one
-
-
4-(3-bromophenyl)-1-[(3-chlorophenyl)sulfonyl]azetidin-2-one

-
-
4-(3-bromophenyl)-1-[(3-chlorophenyl)sulfonyl]azetidin-2-one
-
-
4-[(3-methyl-2-oxoazetidin-1-yl)sulfonyl]benzonitrile

-
-
4-[(3-methyl-2-oxoazetidin-1-yl)sulfonyl]benzonitrile
-
-
benzyl (2S)-1-[(4-methylphenyl)sulfonyl]-4-oxoazetidine-2-carboxylate

-
-
benzyl (2S)-1-[(4-methylphenyl)sulfonyl]-4-oxoazetidine-2-carboxylate
-
-
dichloroisocoumarin

-
below 0.1 mM
dichloroisocoumarin
-
below 0.1 mM
dichloroisocoumarin
-
below 0.1 mM
dichloroisocoumarin
-
below 0.1 mM
N-(2,6-dimethylphenyl)-3,3,3-trifluoro-2-(trifluoromethyl)propanamide

-
-
N-(2,6-dimethylphenyl)-3,3,3-trifluoro-2-(trifluoromethyl)propanamide
-
-
N-[2-(cyclopentyloxy)phenyl]-3,3,3-trifluoro-2-(trifluoromethyl)propanamide

-
-
N-[2-(cyclopentyloxy)phenyl]-3,3,3-trifluoro-2-(trifluoromethyl)propanamide
-
-
N-[2-(cyclopropylmethoxy)phenyl]-3,3,3-trifluoro-2-(trifluoromethyl)propanamide

-
-
N-[2-(cyclopropylmethoxy)phenyl]-3,3,3-trifluoro-2-(trifluoromethyl)propanamide
-
-
phenyl 2-oxo-4-phenylazetidine-1-carboxylate

-
-
phenyl 2-oxo-4-phenylazetidine-1-carboxylate
-
beta-lactam inhibitor, forms a single bond to the catalytic serine and the carbonyl oxygen of the inhibitor faces away from the oxyanion hole. The hydrophobic N-substituent of the inhibitor points into a cavity within the enzyme, providing a structural explanation for the specificity of beta-lactams on rhomboid proteases. This same cavity probably represents the S2' substrate binding site
phenyl 2-oxo-4-phenylazetidine-1-carboxylate
-
-
tert-butyl 2-[[3,3,3-trifluoro-2-(trifluoromethyl)propanoyl]amino]benzoate

-
-
tert-butyl 2-[[3,3,3-trifluoro-2-(trifluoromethyl)propanoyl]amino]benzoate
-
-
additional information

-
no inhibition by EDTA, o-phenanthroline, E64, PMSF, 4-(2-aminoethyl)benzenesulfonyl fluoride and pepstatin A
-
additional information
-
no inhibition by EDTA, o-phenanthroline, E64, PMSF, 4-(2-aminoethyl)benzenesulfonyl fluoride and pepstatin A
-
additional information
-
no inhibition by EDTA, o-phenanthroline, E64, PMSF, 4-(2-aminoethyl)benzenesulfonyl fluoride and pepstatin A
-
additional information
-
local perturbations around the active site hinder proteolytic activity
-
additional information
-
identification of beta-lactone inhititors that form covalent and irreversible complexes with the active site serine of GlpG. The presence of alkyne handles on the beta-lactones also allows activity-based labeling
-
additional information
-
no inhibition by EDTA, o-phenanthroline, E64, PMSF, 4-(2-aminoethyl)benzenesulfonyl fluoride and pepstatin A
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
0.07
(3S,4S)-1-[(4-chlorophenyl)sulfonyl]-3-methyl-4-phenylazetidin-2-one
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.03
(3S,4S)-3-methyl-1-[(4-methylphenyl)sulfonyl]-4-phenylazetidin-2-one
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.0038
1-(2,3-dihydro-4H-1,4-benzoxazin-4-yl)-3,3,3-trifluoro-2-(trifluoromethyl)propan-1-one
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.014
1-(biphenyl-3-ylsulfonyl)-4-phenylazetidin-2-one
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.041
1-(biphenyl-4-ylsulfonyl)-4-phenylazetidin-2-one
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.043
1-[(3'-methylbiphenyl-4-yl)sulfonyl]-4-phenylazetidin-2-one
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.016
1-[(3-bromophenyl)sulfonyl]-4-phenylazetidin-2-one
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.033
1-[(3-chlorophenyl)sulfonyl]-4-(2-phenylethyl)azetidin-2-one
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.085
1-[(3-chlorophenyl)sulfonyl]-4-(propan-2-yl)azetidin-2-one
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.047
1-[(4'-chlorobiphenyl-4-yl)sulfonyl]-4-phenylazetidin-2-one
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.026
1-[(4-bromophenyl)sulfonyl]-4-phenylazetidin-2-one
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.026
1-[(4-chlorophenyl)sulfonyl]-3-methylazetidin-2-one
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.074
1-[(4-methylphenyl)sulfonyl]-4-phenylazetidin-2-one
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.0033
3,3,3-trifluoro-N-[(5-methyl-2-phenyl-2H-1,2,3-triazol-4-yl)methyl]-2-(trifluoromethyl)propanamide
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.0023
3,3,3-trifluoro-N-[2-(propan-2-yloxy)phenyl]-2-(trifluoromethyl)propanamide
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.0183
4-(2-chlorophenyl)-1-[(3-chlorophenyl)sulfonyl]azetidin-2-one
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.0068
4-(3-bromophenyl)-1-[(3-chlorophenyl)sulfonyl]azetidin-2-one
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.02
4-[(3-methyl-2-oxoazetidin-1-yl)sulfonyl]benzonitrile
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.0004
7-amino-3-butoxy-4-chloro-1H-isochromen-1-one
Escherichia coli
-
pH 7.3, 37°C
0.0011
7-amino-4-chloro-3-(2-phenylethoxy)-1H-isochromen-1-one
Escherichia coli
-
pH 7.3, 37°C
0.006
7-amino-4-chloro-3-methoxyisocoumarin
Escherichia coli
-
in 50 mM HEPES-NaOH (pH 7.5), 0.4 M NaCl, 5 mM EDTA, 10% (v/v) glycerol, and 0.05% (w/v) n-dodecyl-beta-D-maltoside, at 37°C
0.00075
7-amino-4-chloro-3-[(5-phenylpentyl)oxy]-1H-isochromen-1-one
Escherichia coli
-
pH 7.3, 37°C
0.029
benzyl (2S)-1-[(4-methylphenyl)sulfonyl]-4-oxoazetidine-2-carboxylate
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.017
N-(2,6-dimethylphenyl)-3,3,3-trifluoro-2-(trifluoromethyl)propanamide
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.0018
N-[2-(cyclopentyloxy)phenyl]-3,3,3-trifluoro-2-(trifluoromethyl)propanamide
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.001
N-[2-(cyclopropylmethoxy)phenyl]-3,3,3-trifluoro-2-(trifluoromethyl)propanamide
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.182
phenyl 2-oxo-4-phenylazetidine-1-carboxylate
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
0.0013
tert-butyl 2-[[3,3,3-trifluoro-2-(trifluoromethyl)propanoyl]amino]benzoate
Providencia stuartii
-
25 mM HEPES, pH 7.4, 5 mM EDTA, 5% (v/v) glycerol, 0.5% (w/v) DDM, 20% (v/v) DMSO, at 25°C
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.