Information on EC - mitogen-activated protein kinase and Organism(s) Homo sapiens and UniProt Accession P45984

for references in articles please use BRENDA:EC2.7.11.24
Word Map on EC
Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Specify your search results
Select one or more organisms in this record:
This record set is specific for:
Homo sapiens

The taxonomic range for the selected organisms is: Homo sapiens

The enzyme appears in selected viruses and cellular organisms

GeneOntology No.
mitogen-activated protein kinase
phospho group transfer
IUBMB Comments
ATP:protein phosphotransferase (MAPKK-activated)
Phosphorylation of specific tyrosine and threonine residues in the activation loop of this enzyme by EC, mitogen-activated protein kinase kinase (MAPKK) is necessary for enzyme activation. Once activated, the enzyme phosphorylates target substrates on serine or threonine residues followed by a proline [6]. A distinguishing feature of all MAPKs is the conserved sequence Thr-Xaa-Tyr (TXY). Mitogen-activated protein kinase (MAPK) signal transduction pathways are among the most widespread mechanisms of cellular regulation. Mammalian MAPK pathways can be recruited by a wide variety of stimuli including hormones (e.g. insulin and growth hormone), mitogens (e.g. epidermal growth factor and platelet-derived growth factor), vasoactive peptides (e.g. angiotensin-II and endothelin), inflammatory cytokines of the tumour necrosis factor (TNF) family and environmental stresses such as osmotic shock, ionizing radiation and ischaemic injury.
MAPK cascade proteins bind to each other selectively via docking interactions. The high selectivity of JNK family MAPKs for cognate binding partners is controlled by two key hydrophobic residues in the docking site
physiological function
additional information
(Substrate) hide
(Product) hide
?=not specified
ADP + phosphorylated ATF2
show the reaction diagram
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
ATP + c-Jun activation domain
ADP + phosphorylated c-Jun activation domain
show the reaction diagram
JNK2 binds c-Jun approximately 25 times more efficiently than JNK1
ATP + Elk-1
ADP + phosphorylated Elk-1
show the reaction diagram
an ETS family transcription factor with modified D-site by swapping two hydrophobic residues
ATP + Net
ADP + phosphorylated Net
show the reaction diagram
an ETS family transcription factor with modified D-site by swapping two hydrophobic residues
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
ADP + phosphorylated ATF-2
show the reaction diagram
ADP + a phosphorylated ATF2
show the reaction diagram
substrate in assay, biotinylated ATF2
ADP + phosphorylated ATF2
show the reaction diagram
ATP + Bcl-2
ADP + phosphorylated Bcl-2
show the reaction diagram
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
ATP + c-Jun activation domain
ADP + phosphorylated c-Jun activation domain
show the reaction diagram
enzyme binds to the c-Jun transactivation domain and phosphorylates it on Ser63 and Ser73
ATP + c-Jun transcription factor
ADP + phosphorylated c-Jun transcription factor
show the reaction diagram
JNK phosphorylates the N-terminal transactivation domain of c-Jun transcription factor
ATP + Elk-1
ADP + phosphorylated Elk-1
show the reaction diagram
ATP + FITC-Aca-Ala-Ala-Ala-Thr-Gly-Pro-Leu-Ser-Pro-Gly-Pro-Phe-Ala-NH2
ADP + phosphorylated FITC-Aca-Ala-Ala-Ala-Thr-Gly-Pro-Leu-Ser-Pro-Gly-Pro-Phe-Ala-NH2
show the reaction diagram
FITC-labeled ERK substrate peptide
ATP + focal adhesion kinase
ADP + phosphorylated focal adhesion kinase
show the reaction diagram
phosphorylation of FAK at S910, which promotes the disassembly of focal adhesion (hemidesmosome disruption) during cell migration
ATP + GST-c-Jun
ADP + phosphorylated GST-c-Jun
show the reaction diagram
substrate in kinase activity assay
ATP + human glucocorticoid receptor
ADP + phosphorylated human glucocorticoid receptor
show the reaction diagram
ADP + phosphorylated IRS-1
show the reaction diagram
phosphorylation of the insulin receptor substrate IRS-1 at serine 307
ATP + Lin-1
ADP + phosphorylated Lin-1
show the reaction diagram
ADP + phosphorylated MAPK
show the reaction diagram
ATP + MAPKAP kinase-2
ADP + phosphorylated MAPKAP kinase-2
show the reaction diagram
ATP + MAPKAP kinase-3
ATP + phosphorylated MAPKAP kinase-3
show the reaction diagram
ADP + phosphorylated MAPKAPK2
show the reaction diagram
ATP + MAPKAPK2-peptide
ADP + phosphorylated MAPKAPK2-peptide
show the reaction diagram
the peptide substrate is derived from a sequence of a mitogen-activated protein kinase activated protein kinase-2, MAPKAPK2, phopshorylation site
ADP + phosphorylated MK2
show the reaction diagram
ADP + phosphorylated MMP-9
show the reaction diagram
ATP + multifunctional protein CAD
ADP + phosphorylated multifunctional protein CAD
show the reaction diagram
ATP + myelin basic protein
ADP + phosphorylated myelin basic protein
show the reaction diagram
substrate in in vitro kinase assay
ATP + Net
ADP + phosphorylated Net
show the reaction diagram
ATP + protein
ADP + phosphoprotein
show the reaction diagram
ATP + protein APP
ADP + phosphorylated protein APP
show the reaction diagram
ATP + protein ATF2
ADP + phosphorylated protein ATF2
show the reaction diagram
ATP + protein EGFRP
ADP + phosphorylated protein EGFRP
show the reaction diagram
epidermal growth factor receptor peptide, substrate in kinase activity assay
ATP + transcription factor ATF2
ADP + phosphorylated transcription factor ATF2
show the reaction diagram
ATP + transcription factor Elk-1
ADP + phosphorylated transcription factor Elk-1
show the reaction diagram
ATP + transcription factor SAP-1
ADP + phosphorylated transcription factor SAP-1
show the reaction diagram
additional information
(Substrate) hide
(Product) hide
?=not specified
ADP + phosphorylated ATF2
show the reaction diagram
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
ADP + phosphorylated ATF2
show the reaction diagram
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
ATP + Elk-1
ADP + phosphorylated Elk-1
show the reaction diagram
an ETS family transcription factor
ATP + human glucocorticoid receptor
ADP + phosphorylated human glucocorticoid receptor
show the reaction diagram
specific phosphorylation at Ser211 by p38 MAPK, p38 MAPK is a mediator in glucocorticoid-induced apoptosis of lymphoid cells, interaction of MAPK and glucocorticoid pathways, overview
ATP + Lin-1
ADP + phosphorylated Lin-1
show the reaction diagram
substrate of ERK2, negative regulation of Lin-1
ADP + phosphorylated MAPKAPK2
show the reaction diagram
ADP + phosphorylated MMP-9
show the reaction diagram
activity of p38 MAP kinase, TNF-alpha stimulates MMP-9 expression via the p38 MAP kinase signaling pathway in 5637 cells, and p38 MAP kinase-mediated MMP-9 gene regulation in response to TNF-alpha is involved in the NF-kappaB response element in 5637 cells, regulation, overview
ATP + multifunctional protein CAD
ADP + phosphorylated multifunctional protein CAD
show the reaction diagram
CAD initiates and regulates de novo pyrimidine biosynthesis and is activated by phosphorylation at Thr456 by nuclear MAPKs, nuclear import of CAD is required for optimal cell growth
ATP + Net
ADP + phosphorylated Net
show the reaction diagram
an ETS family transcription factor
additional information
partially restores the ability of the protein to dimerize
furan-2-carboxylic acid (3-[5-(4H-[1,2,4]triazol-3-yl)-1H-indazol-3-yl]-phenyl)-amide
inhibits JNK2alpha2 enzyme in vitro
wild-type and L44I mutant MKK4, the D-site from enzyme MKK4 competitively inhibits JNK-mediated phosphorylation of c-Jun and ATF2
MKK4 mutant F48K
the D-site from enzyme MKK4 competitively inhibits JNK-mediated phosphorylation of c-Jun and ATF2, but to a lesser degree compared to the wild-type MKK4
MKK4 mutant L44I
wild-type and L44I mutant MKK4, the D-site from enzyme MKK4 competitively inhibits JNK-mediated phosphorylation of c-Jun and ATF2
(3R)-3-([4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)butanoic acid
(R)-2-(sec-butylamino)-N-(2-methyl-5-(methylcarbamoyl)phenyl) thiazole-5-carboxamide
i.e. BMS-640994, a potent and efficacious p38alpha MAP kinase inhibitor; inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
2-bromothiazole-5-carboxylic acid
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole-5-sulfonic acid
PH-797804, ATP-competitive, readily reversible inhibitor of the alpha isoform of human p38 MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
crystal structure analysis of the inhibitor bound to p38
4-[(1H-benzimidazol-2-ylsulfanyl)methyl]benzoic acid
4-[3-amino-4-(2,4-difluorobenzoyl)-1-oxidopyridin-2-yl]-3-methylbenzoic acid
4-[[(6-amino-9H-purin-8-yl)sulfanyl]methyl]benzoic acid
inhibition of JNK/SAPK1c, SAPK2a/p38, SAPK2b/p38beta, SAPK3/p38gamma, and SAPK4/p38delta
ARRY-142886, MEK1/2 inhibitor
BIRB 796
calcium diphosphate
crystals in plasma inhibit the p38 MAP kinase mediating the activation of neutrophils and repression of TNF-alpha-induced apoptosis
a potent inhibitor of MEK
ethyl 1-[5-([5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]carbamoyl)-2-methylphenyl]-2,3-dihydro-1H-1,2,3-triazole-4-carboxylate
ERK inhibitor, 5-(2-phenyl-pyrazolo[1,5-a]pyridin-3-yl)-1H-pyrazolo[3,4-c]pyridazin-3-ylamine
79% inhibition at 0.01 mM of JNK/SAPK1c, 17% inhibition at 0.01 mM of SAPK2a/p38, 55% inhibition at 0.01 mM of SAPK2b/p38beta, 26% inhibition at 0.01 mM of SAPK3/p38gamma, and 35% inhibition at 0.01 mM of SAPK4/p38delta
slight inhibition of SAPK2a/p38 and SAPK3/p38gamma, no inhibition of SAPK4/p38delta, JNK/SAPK1c, SAPK2b/p38beta, and SAPK4/p38delta
wild-type MKK4, the D-site from enzyme MKK4 competitively inhibits JNK-mediated phosphorylation of c-Jun and ATF2
MKK4 mutant F48K
the D-site from enzyme MKK4 competitively inhibits JNK-mediated phosphorylation of c-Jun and ATF2, but to a lesser degree compared to the wild-type MKK4
MKK4 mutant L44I
the D-site from enzyme MKK4 competitively inhibits JNK-mediated phosphorylation of c-Jun and ATF2
Mycophenolic acid
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
inhibition of p38alpha MAP kinase
panduratin A
selective inhibitor of mitogen-activated extracellular regulated kinase phosphorylation, arrests cells in G(0)/G(1), increases P21/waf1 antigen expression
peptide corresponding to the D-domain of JIP-1, final sequence of the most extensively used peptide is GRKKRRQRRRPPRPKRPTTLNLFPQVPRSQDT
16% inhibition at 0.01 mM of JNK/SAPK1c, no inhibition of SAPK2a/p38, SAPK3/p38gamma, and SAPK4/p38delta
S-1,3-benzothiazol-2-yl (2Z)-(2-amino-1,3-thiazol-4-yl)(methoxyimino)ethanethioate
SB 203580
no preference for either active or inactive p38alpha, no preincubation required to achieve maximum inhibition
p38 inhibitor SB202
tert-butyl 4-(2-[[(5-bromofuran-2-yl)carbonyl]amino]-6-chlorophenyl)piperazine-1-carboxylate
[Nle4, D-Phe7]alpha-melanocyte stimulating hormone
NDP-MSH, the melanocortin agonist dose-dependently inhibits JNK activity in HEK-293 cells stably expressing the human melanocortin receptor type 4
additional information
up-regulates ERK1/2 phosphorylation and activity 8fold at 0.01 mM, the addition of nor-binaltorphimine (100 nM) reduces the amitriptyline stimulatory effect by 70%
the exposure of HEK-293 and HeLa cells to citrinin results in a dose-dependent increase in the phosphorylation of ERK1/2 and JNK
activate p38 MAPK, e.g. by induction of activating MKK3
activates the MAPKs, dexamethasone inhibits this activation
mitogen-activated protein kinase kinase 6
mycosporine-like amino acids shinorine, mycosporine-glycine, and porphyra are purified from Chlamydomonas hedlyei and Porphyra yezoensis activate kinase ERK and JNK, especially JNK
mycosporine-like amino acids shinorine, mycosporine-glycine, and porphyra are purified from Chlamydomonas hedlyei and Porphyra yezoensis activate kinase ERK and JNK, especially JNK
Porphyromonas gingivalis supernatant
17% activation of SAPK2b/p38beta
Ras induces phosphorylation of c-Jun by JNKs
mycosporine-like amino acids shinorine, mycosporine-glycine, and porphyra are purified from Chlamydomonas hedlyei and Porphyra yezoensis activate kinase ERK and JNK, especially JNK
stimulates 4-5fold the expression of p44/p42
transforming growth factor-beta
i.e. TGF-beta, activates p38, butenoside inhibits this activation
tumor necrosis factor-alpha
additional information
protein ATF2
pH 7.6, 27C, purified, recombinant detagged, activated p38 MAPKalpha
additional information
additional information
constants of dissociation and thermodynamic parameters of p38gamma binding with different PTPN4 constructs, overview
protein ATF2
pH 7.6, 27C, purified, recombinant detagged, activated p38 MAPKalpha
(3R)-3-([4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)butanoic acid
0.000002 - 0.000003
(S)-4-[2-(2-chloro-4-fluorophenylamino)-5-methylpyrimidin-4-yl]- N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
Ki below 0.000002 mM, potent, selective, and orally bioavailable inhibitor of ERK
Ki below 0.000002 mM
Ki below 0.000002 mM
Ki below 0.000002 mM
Ki below 0.000002 mM
Ki below 0.000002 mM
Ki below 0.000002 mM
Ki below 0.000002 mM
Ki below 0.000002 mM
Ki below 0.000002 mM
Ki below 0.000002 mM
Ki below 0.000002 mM
Ki below 0.000002 mM
inhibition of p38 MAPK
inhibition of p38 MAPK
inhibition of p38 MAPK
inhibition of p38 MAPK
inhibition of p38 MAPK
inhibition of p38 MAPK
inhibition of p38 MAPK
inhibition of p38 MAPK
inhibition of p38 MAPK
inhibition of p38 MAPK
inhibition of p38 MAPK
inhibition of p38 MAPK
inhibition of p38 MAPK
inhibition of p38 MAPK
inhibition of p38 MAPK
inhibition of p38 MAPK
inhibition of p38 MAPK
0.000012 - 0.000017
furan-2-carboxylic acid (3-[5-(4H-[1,2,4]triazol-3-yl)-1H-indazol-3-yl]-phenyl)-amide
Homo sapiens;
Homo sapiens;
pH 7.5, 30C, wild-type MKK4, JNK2, substrate c-Jun
MKK4 mutant F48K
Homo sapiens;
pH 7.5, 30C, JNK2, wild-type MKK4, substrate c-Jun
MKK4 mutant L44I
Homo sapiens;
pH 7.5, 30C, JNK2, wild-type MKK4, substrate c-Jun
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
(R)-2-(sec-butylamino)-N-(2-methyl-5-(methylcarbamoyl)phenyl) thiazole-5-carboxamide
Homo sapiens;
Homo sapiens;
THP-1 cells
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
larger than 0.050
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
0.00031 - 0.00033
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
larger than 0.100
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole-5-sulfonic acid
Homo sapiens;
larger than 0.050
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
0.0064 - 0.0071
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
IC50 with THP-1 cells
Homo sapiens;
IC50 with THP-1 cells
Homo sapiens;
IC50 with THP-1 cells
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
0.00028 - 0.0005
Homo sapiens;
Homo sapiens;
4-[(1H-benzimidazol-2-ylsulfanyl)methyl]benzoic acid
Homo sapiens;
larger than 0.100
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
4-[3-amino-4-(2,4-difluorobenzoyl)-1-oxidopyridin-2-yl]-3-methylbenzoic acid
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;
Homo sapiens;