show all | hide all No of entries

Information on EC 2.7.11.24 - mitogen-activated protein kinase and Organism(s) Homo sapiens and UniProt Accession P45984

for references in articles please use BRENDA:EC2.7.11.24
Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
EC Tree
IUBMB Comments
Phosphorylation of specific tyrosine and threonine residues in the activation loop of this enzyme by EC 2.7.12.2, mitogen-activated protein kinase kinase (MAPKK) is necessary for enzyme activation. Once activated, the enzyme phosphorylates target substrates on serine or threonine residues followed by a proline . A distinguishing feature of all MAPKs is the conserved sequence Thr-Xaa-Tyr (TXY). Mitogen-activated protein kinase (MAPK) signal transduction pathways are among the most widespread mechanisms of cellular regulation. Mammalian MAPK pathways can be recruited by a wide variety of stimuli including hormones (e.g. insulin and growth hormone), mitogens (e.g. epidermal growth factor and platelet-derived growth factor), vasoactive peptides (e.g. angiotensin-II and endothelin), inflammatory cytokines of the tumour necrosis factor (TNF) family and environmental stresses such as osmotic shock, ionizing radiation and ischaemic injury.
Specify your search results
Select one or more organisms in this record:
This record set is specific for:
Homo sapiens
UNIPROT: P45984
Word Map
The taxonomic range for the selected organisms is: Homo sapiens
The enzyme appears in selected viruses and cellular organisms
Reaction Schemes
Synonyms
mapk, p38, erk1/2, p38 mapk, map kinase, extracellular signal-regulated kinase, p38 mitogen-activated protein kinase, p38 map kinase, p38mapk, mek1/2, more
SYNONYM
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
BMK1
266266
-
c-Jun N-terminal kinase
c-jun N-terminal kinase 1
c-Jun N-terminal kinase 2
c-Jun N-terminal kinase 3
c-Jun NH2-terminal kinase
247
-
c-jun NH2-terminal MAPK
247
-
cp38a
-
-
-
-
cp38b
-
-
-
-
CSAID binding protein
-
-
-
-
CSBP
-
-
-
-
Cytokine suppressive anti-inflammatory drug binding protein
-
-
-
-
ERK3
266268
-
ERK5
-
-
-
-
extracellular regulated kinase
266239, 266243
-
extracellular signal-regulated kinase
266239, 266243
-
extracellular signal-regulated kinase 1
266239
-
extracellular signal-regulated kinase 1/2
247
-
extracellular signal-regulated kinase 2
extracellular signal-regulated kinases-1/2
247
-
extracellular signal-related kinase
247
-
JNK 2
266252
-
JNK/SAPK1c
247
-
JNK1alpha1
266251
-
JNK2alpha2
266252
-
MAP kinase MXI2
-
-
-
-
MAP kinase p38 beta
-
-
-
-
MAP kinase p38 delta
-
-
-
-
MAP kinase p38 gamma
-
-
-
-
MAP kinase p38a
-
-
-
-
MAP kinase p38alpha
-
-
-
-
MAP kinase p38b
-
-
-
-
MAPK kinase
247
-
MAPK11
266267
-
MAPK12
296678
-
MAPK14
285973
-
MAPK3
266239
-
MAPK8
266251
-
MAPK9
266252
-
MEK
247
-
MEK1/2
247
-
mitogen-activated protein kinase
mitogen-activated protein kinase 1
266243
-
mitogen-activated protein kinase 10
266258
-
mitogen-activated protein kinase 11
266267
-
mitogen-activated protein kinase 13
266231
-
mitogen-activated protein kinase 3
266239
-
mitogen-activated protein kinase 4
266245
-
mitogen-activated protein kinase 6
266268
-
mitogen-activated protein kinase 7
266266
-
mitogen-activated protein kinase 8
266251
-
mitogen-activated protein kinase 9
266252
-
Mitogen-activated protein kinase p38 beta
-
-
-
-
Mitogen-activated protein kinase p38 delta
-
-
-
-
Mitogen-activated protein kinase p38 gamma
-
-
-
-
Mitogen-activated protein kinase p38a
-
-
-
-
Mitogen-activated protein kinase p38alpha
-
-
-
-
Mitogen-activated protein kinase p38b
-
-
-
-
mitogen-activated protein kinase p44erk1
266239
-
mitogen-activated protein kinase/extracellular signal-regulated kinase 1/2 kinase
247
-
p38 MAP kinase
p38 MAPK
p38 MAPKalpha
247
-
p38 mitogen activated protein kinase
247
-
p38 mitogen-activated protein kinase
p38 mitogen-activated protein kinase alpha
247
-
p38 protein
247
-
p38-2
266267
-
p38-delta mitogen-activated protein kinase
266231
-
p38-MAPK
247
-
p38alpha
p38alpha MAP kinase
247
-
p38alpha mitogen-activated protein kinase
P38alpha-MAPKAP kinase 2
247
-
p38b
-
-
-
-
p38beta
266267
-
p38delta
266231
-
p38gamma
296678
-
p38MAPK
247
-
p42
247
-
p44
247
-
p493F12 kinase
266258
-
p97MAPK
266268
-
SAPK
247
-
SAPK2A
-
-
-
-
SAPK2a/p38
247
-
SAPK2b/p38beta
247
-
SAPK3/p38gamma
247
-
SAPK4
266231
-
SAPK4/p38delta
247
-
SAPKalphaI/JNK2
247
-
signal-regulated kinase 3
266268
-
stress-activated protein kinase 2a
-
-
-
-
stress-activated protein kinase-4
266231
-
additional information
247
the enzyme belongs to the MAPK superfamily of enzymes
REACTION TYPE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
phospho group transfer
SYSTEMATIC NAME
IUBMB Comments
ATP:protein phosphotransferase (MAPKK-activated)
Phosphorylation of specific tyrosine and threonine residues in the activation loop of this enzyme by EC 2.7.12.2, mitogen-activated protein kinase kinase (MAPKK) is necessary for enzyme activation. Once activated, the enzyme phosphorylates target substrates on serine or threonine residues followed by a proline [6]. A distinguishing feature of all MAPKs is the conserved sequence Thr-Xaa-Tyr (TXY). Mitogen-activated protein kinase (MAPK) signal transduction pathways are among the most widespread mechanisms of cellular regulation. Mammalian MAPK pathways can be recruited by a wide variety of stimuli including hormones (e.g. insulin and growth hormone), mitogens (e.g. epidermal growth factor and platelet-derived growth factor), vasoactive peptides (e.g. angiotensin-II and endothelin), inflammatory cytokines of the tumour necrosis factor (TNF) family and environmental stresses such as osmotic shock, ionizing radiation and ischaemic injury.
CAS REGISTRY NUMBER
COMMENTARY hide
142243-02-5
-
SUBSTRATE
PRODUCT                       
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
Reversibility
r=reversible
ir=irreversible
?=not specified
ATP + ATF2
ADP + phosphorylated ATF2
show the reaction diagram
-
-
-
-
?
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
-
-
-
-
?
ATP + c-Jun activation domain
ADP + phosphorylated c-Jun activation domain
show the reaction diagram
-
JNK2 binds c-Jun approximately 25 times more efficiently than JNK1
-
-
-
ATP + Elk-1
ADP + phosphorylated Elk-1
show the reaction diagram
-
an ETS family transcription factor with modified D-site by swapping two hydrophobic residues
-
-
?
ATP + Net
ADP + phosphorylated Net
show the reaction diagram
-
an ETS family transcription factor with modified D-site by swapping two hydrophobic residues
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
ATP + ATF-2
ADP + phosphorylated ATF-2
show the reaction diagram
ATP + ATF2
ADP + a phosphorylated ATF2
show the reaction diagram
-
substrate in assay, biotinylated ATF2
-
-
-
ATP + ATF2
ADP + phosphorylated ATF2
show the reaction diagram
ATP + Bcl-2
ADP + phosphorylated Bcl-2
show the reaction diagram
-
-
-
-
?
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
ATP + c-Jun activation domain
ADP + phosphorylated c-Jun activation domain
show the reaction diagram
-
enzyme binds to the c-Jun transactivation domain and phosphorylates it on Ser63 and Ser73
-
-
-
ATP + c-Jun transcription factor
ADP + phosphorylated c-Jun transcription factor
show the reaction diagram
-
JNK phosphorylates the N-terminal transactivation domain of c-Jun transcription factor
-
-
?
ATP + Elk-1
ADP + phosphorylated Elk-1
show the reaction diagram
ATP + FITC-Aca-Ala-Ala-Ala-Thr-Gly-Pro-Leu-Ser-Pro-Gly-Pro-Phe-Ala-NH2
ADP + phosphorylated FITC-Aca-Ala-Ala-Ala-Thr-Gly-Pro-Leu-Ser-Pro-Gly-Pro-Phe-Ala-NH2
show the reaction diagram
-
FITC-labeled ERK substrate peptide
-
-
?
ATP + focal adhesion kinase
ADP + phosphorylated focal adhesion kinase
show the reaction diagram
-
phosphorylation of FAK at S910, which promotes the disassembly of focal adhesion (hemidesmosome disruption) during cell migration
-
-
?
ATP + GST-c-Jun
ADP + phosphorylated GST-c-Jun
show the reaction diagram
-
substrate in kinase activity assay
-
-
?
ATP + human glucocorticoid receptor
ADP + phosphorylated human glucocorticoid receptor
show the reaction diagram
ATP + IRS-1
ADP + phosphorylated IRS-1
show the reaction diagram
-
phosphorylation of the insulin receptor substrate IRS-1 at serine 307
-
-
?
ATP + Lin-1
ADP + phosphorylated Lin-1
show the reaction diagram
ATP + MAPK
ADP + phosphorylated MAPK
show the reaction diagram
-
-
-
-
?
ATP + MAPKAP kinase-2
ADP + phosphorylated MAPKAP kinase-2
show the reaction diagram
-
-
-
-
-
ATP + MAPKAP kinase-3
ATP + phosphorylated MAPKAP kinase-3
show the reaction diagram
-
-
-
-
-
ATP + MAPKAPK2
ADP + phosphorylated MAPKAPK2
show the reaction diagram
-
-
-
-
?
ATP + MAPKAPK2-peptide
ADP + phosphorylated MAPKAPK2-peptide
show the reaction diagram
-
the peptide substrate is derived from a sequence of a mitogen-activated protein kinase activated protein kinase-2, MAPKAPK2, phopshorylation site
-
-
?
ATP + MK2
ADP + phosphorylated MK2
show the reaction diagram
-
-
-
-
?
ATP + MMP-9
ADP + phosphorylated MMP-9
show the reaction diagram
ATP + multifunctional protein CAD
ADP + phosphorylated multifunctional protein CAD
show the reaction diagram
ATP + myelin basic protein
ADP + phosphorylated myelin basic protein
show the reaction diagram
-
substrate in in vitro kinase assay
-
-
?
ATP + Net
ADP + phosphorylated Net
show the reaction diagram
ATP + protein
ADP + phosphoprotein
show the reaction diagram
ATP + protein APP
ADP + phosphorylated protein APP
show the reaction diagram
-
-
-
-
?
ATP + protein ATF2
ADP + phosphorylated protein ATF2
show the reaction diagram
ATP + protein EGFRP
ADP + phosphorylated protein EGFRP
show the reaction diagram
-
epidermal growth factor receptor peptide, substrate in kinase activity assay
-
-
?
ATP + transcription factor ATF2
ADP + phosphorylated transcription factor ATF2
show the reaction diagram
-
-
-
-
-
ATP + transcription factor Elk-1
ADP + phosphorylated transcription factor Elk-1
show the reaction diagram
-
-
-
-
-
ATP + transcription factor SAP-1
ADP + phosphorylated transcription factor SAP-1
show the reaction diagram
-
-
-
-
-
additional information
?
-
NATURAL SUBSTRATE
NATURAL PRODUCT
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
REVERSIBILITY
r=reversible
ir=irreversible
?=not specified
ATP + ATF2
ADP + phosphorylated ATF2
show the reaction diagram
-
-
-
-
?
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
ATP + ATF2
ADP + phosphorylated ATF2
show the reaction diagram
-
-
-
-
?
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
ATP + Elk-1
ADP + phosphorylated Elk-1
show the reaction diagram
-
an ETS family transcription factor
-
-
?
ATP + human glucocorticoid receptor
ADP + phosphorylated human glucocorticoid receptor
show the reaction diagram
-
specific phosphorylation at Ser211 by p38 MAPK, p38 MAPK is a mediator in glucocorticoid-induced apoptosis of lymphoid cells, interaction of MAPK and glucocorticoid pathways, overview
-
-
?
ATP + Lin-1
ADP + phosphorylated Lin-1
show the reaction diagram
P53778
substrate of ERK2, negative regulation of Lin-1
-
-
?
ATP + MAPKAPK2
ADP + phosphorylated MAPKAPK2
show the reaction diagram
-
-
-
-
?
ATP + MMP-9
ADP + phosphorylated MMP-9
show the reaction diagram
-
activity of p38 MAP kinase, TNF-alpha stimulates MMP-9 expression via the p38 MAP kinase signaling pathway in 5637 cells, and p38 MAP kinase-mediated MMP-9 gene regulation in response to TNF-alpha is involved in the NF-kappaB response element in 5637 cells, regulation, overview
-
-
?
ATP + multifunctional protein CAD
ADP + phosphorylated multifunctional protein CAD
show the reaction diagram
-
CAD initiates and regulates de novo pyrimidine biosynthesis and is activated by phosphorylation at Thr456 by nuclear MAPKs, nuclear import of CAD is required for optimal cell growth
-
-
?
ATP + Net
ADP + phosphorylated Net
show the reaction diagram
-
an ETS family transcription factor
-
-
?
additional information
?
-
METALS and IONS
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
Mg2+
-
required
Ca2+
-
partially restores the ability of the protein to dimerize
INHIBITOR
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
furan-2-carboxylic acid (3-[5-(4H-[1,2,4]triazol-3-yl)-1H-indazol-3-yl]-phenyl)-amide
inhibits JNK2alpha2 enzyme in vitro
MKK4
-
wild-type and L44I mutant MKK4, the D-site from enzyme MKK4 competitively inhibits JNK-mediated phosphorylation of c-Jun and ATF2
-
MKK4 mutant F48K
-
the D-site from enzyme MKK4 competitively inhibits JNK-mediated phosphorylation of c-Jun and ATF2, but to a lesser degree compared to the wild-type MKK4
-
MKK4 mutant L44I
-
wild-type and L44I mutant MKK4, the D-site from enzyme MKK4 competitively inhibits JNK-mediated phosphorylation of c-Jun and ATF2
-
(1R)-2-([4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)cyclohexanol
-
-
(1R,2S)-2-[([4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)methyl]cyclohexanol
-
-
(2R)-2-([4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)propan-1-ol
-
-
(2S,3S)-2-[(R)-4-[4-(2-hydroxy-ethoxy)-phenyl]-2,5-dioxo-imidazolidin-1-yl]-3-phenyl-N-(4-propionyl-thiazol-2-yl)-butyramide
-
RO4927350
(3-amino-1-oxido-2-phenylpyridin-4-yl)(phenyl)methanone
-
-
(3R)-3-([4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)butanoic acid
-
-
(R)-2-(sec-butylamino)-N-(2-methyl-5-(methylcarbamoyl)phenyl) thiazole-5-carboxamide
-
i.e. BMS-640994, a potent and efficacious p38alpha MAP kinase inhibitor; inhibition of p38alpha MAP kinase
(R)-N-(2-hydroxyl-1-phenylethyl)-4-[5-methyl-2-(phenylamino)-pyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
(S)-4-[2-(2,3-dimethylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
(S)-4-[2-(2-chlorophenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
(S)-4-[2-(2-ethylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
(S)-4-[2-(2-ethylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
(S)-4-[2-(2-fluorophenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
(S)-4-[2-(2-hydroxyphenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
(S)-4-[2-(2-methylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
(S)-4-[2-(2-methylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
(S)-4-[2-(2-trifluoromethylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
(S)-4-[2-(3-fluoro-2-methylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
(S)-4-[2-(4-chloro-2-fluorophenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
(S)-4-[2-(4-chloro-2-methylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
(S)-4-[2-(benzo[d]1,3-dioxolylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
(S)-N-(2-hydroxyl-1-phenylethyl)-4-[5-methyl-2-(phenylamino)-pyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
(S)-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-4-[-2-(2,2-difluorobenzo[d][1,3]dioxol-4-ylamino)-5-methylpyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
(S)-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-4-[-2-(2,3-dihydro-1H-inden-4-ylamino)-5-methylpyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
(S)-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-4-[-2-(2,3-dihydrobenzo[b][1,4]dioxin-5-ylamino)-5-methylpyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
(S)-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-4-[5-methyl-2(5,6,7,8-tetrahydronaphthalen-1-ylamino)pyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
(S)-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-4-[5-methyl-2-(phenylamino)pyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
(S)-N-[1-(3-fluorophenyl)-2-hydroxyethyl]-4-[5-methyl-2-(phenylamino)pyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
(S)-N-[1-(3-methylphenyl)-2-hydroxyethyl]-4-[5-methyl-2-(phenylamino)pyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
1-((S)-4-(6-(3-(cyclopropylamino)-6-methylbenzo[d]isoxazol-7-yl)phthalazin-1-yl)-3-methylpiperazin-1-yl)ethanone
-
-
1-(2,6-dichloro-phenyl)-1-(4-(4-fluorophenyl)thiazol-2-yl)urea
Q16539
-
1-([4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)propan-2-ol
-
-
1-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)propan-2-ol
-
-
1-methyl-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole
-
-
2,2'-disulfanediylbis(1,3-benzothiazole)
-
-
2-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-N-[4-(2-morpholin-4-ylethoxy)naphthalen-1-yl]-2-oxoacetamide
-
-
2-(4-chlorphenyl)-4-(4-fluorophenyl)-5-pyridin-4-yl-1,2-dihydropyrazol-3-one
Q16539
-
2-(5-tert-butyl-2-methylfuran-3-yl)-2-oxo-N-[4-(pyrimidin-2-ylamino)-5,8-dihydronaphthalen-1-yl]acetamide
-
-
2-(5-tert-butyl-2-methylfuran-3-yl)-2-oxo-N-[4-(pyrimidin-4-ylamino)-5,8-dihydronaphthalen-1-yl]acetamide
-
-
2-(5-tert-butyl-2-methylfuran-3-yl)-N-(4-[[6-(morpholin-4-ylmethyl)pyridin-3-yl]methyl]-5,8-dihydronaphthalen-1-yl)-2-oxoacetamide
-
-
2-(5-tert-butyl-2-methylfuran-3-yl)-N-[4-(2-morpholin-4-ylethoxy)naphthalen-1-yl]-2-oxoacetamide
-
-
2-(benzyloxy)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
2-(ethylamino)-N-[5-(ethylcarbamoyl)-2-methylphenyl]-4-methyl-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
2-(ethylsulfanyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
2-([4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)propan-1-ol
-
-
2-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)-3-methylbutan-1-ol
-
-
2-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)butan-1-ol
-
-
2-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)ethanol
-
-
2-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)propan-1-ol
-
-
2-bromo-N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]-1,3-thiazole-5-carboxamide
-
-
2-bromothiazole-5-carboxylic acid
-
inhibition of p38alpha MAP kinase
2-chloro-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
2-chloro-4-[4-(4-fluorophenyl)-2-(phenylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
2-fluoro-4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridine
-
-
2-fluoro-4-[2-(phenylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridine
-
-
2-fluoro-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
2-fluoro-4-[4-(4-fluorophenyl)-2-(phenylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
2-[(1,5-dimethylhexyl)oxy]-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
2-[(1-methylethyl)amino]-N-[2-methyl-5-(1H-pyrazol-5-ylcarbamoyl)phenyl]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
2-[(1-methylethyl)amino]-N-[2-methyl-5-(methylcarbamoyl)phenyl]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
2-[(1-methylethyl)amino]-N-[2-methyl-5-[(1-methyl-1H-pyrazol-5-yl)carbamoyl]phenyl]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
2-[(2,4-dinitrophenyl)sulfanyl]-1,3-benzoxazole
-
-
2-[(2-methoxyethyl)amino]-N-[2-methyl-5-(methylcarbamoyl)phenyl]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzothiazole
-
-
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzoxazole
-
-
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole
-
-
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole-5-sulfonic acid
-
-
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-5-(trifluoromethyl)-1H-benzimidazole
-
-
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl][1,3]thiazolo[4,5-b]pyridine
-
-
2-[3-tert-butyl-1-(3-methylphenyl)-1H-pyrazol-5-yl]-2-(hydroxyamino)-N-[4-(2-morpholin-4-ylethoxy)naphthalen-1-yl]acetamide
-
-
2-[4-[3-(4-chlorophenyl)-4-pyrimidin-4-yl-1H-pyrazol-5-yl]piperidin-1-yl]-2-oxoethanol
Q16539
-
3-(3-bromo-4-[(2,4-difluorobenzyl)oxy]-6-methyl-2-oxopyridin-1(2H)-yl)-N,4-dimethylbenzamide
-
PH-797804, ATP-competitive, readily reversible inhibitor of the alpha isoform of human p38 MAP kinase
3-([4-[2-(cyclopropylamino)pyrimidin-4-yl]-5-(4-fluorophenyl)-1H-imidazol-1-yl]methyl)benzamide
Q16539
-
3-([4-[2-(cyclopropylamino)pyrimidin-4-yl]-5-(4-fluorophenyl)-1H-imidazol-1-yl]methyl)benzonitrile
Q16539
-
3-([4-[2-(cyclopropylamino)pyrimidin-4-yl]-5-(4-fluorophenyl)-1H-imidazol-2-yl]methyl)benzamide
Q16539
-
3-([4-[2-(cyclopropylamino)pyrimidin-4-yl]-5-(4-fluorophenyl)-1H-imidazol-2-yl]methyl)benzonitrile
Q16539
-
3-([4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)cyclohexanol
-
-
3-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)propan-1-ol
-
-
3-([5-[2-(cyclopropylamino)pyrimidin-4-yl]-4-(4-fluorophenyl)-1H-imidazol-1-yl]methyl)benzamide
Q16539
-
3-([5-[2-(cyclopropylamino)pyrimidin-4-yl]-4-(4-fluorophenyl)-1H-imidazol-1-yl]methyl)benzonitrile
Q16539
-
3-bromo-N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]benzamide
-
-
3-[(4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridin-2-yl)amino]propan-1-ol
-
-
3-[2-(cyclopropylamino)-6-oxo-4,6-dihydro-5H-pyrrolo[3,4-d][1,3]thiazol-5-yl]-N,4-dimethylbenzamide
-
inhibition of p38alpha MAP kinase
3-[2-(cyclopropylamino)-6-oxo-4,6-dihydro-5H-pyrrolo[3,4-d][1,3]thiazol-5-yl]-N-ethyl-4-methylbenzamide
-
inhibition of p38alpha MAP kinase
3-[4-(N-benzyl-N-methylglycyl)-2,3-dihydro-1H-1,2,3-triazol-1-yl]-N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methylbenzamide
-
-
3-[4-(N-benzylglycyl)-2,3-dihydro-1H-1,2,3-triazol-1-yl]-N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methylbenzamide
-
crystal structure analysis of the inhibitor bound to p38
3-[4-(N-tert-butylglycyl)-2,3-dihydro-1H-1,2,3-triazol-1-yl]-N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methylbenzamide
-
-
3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
3-[[4-(2-aminopyrimidin-4-yl)-5-(4-fluorophenyl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
3-[[4-(2-aminopyrimidin-4-yl)-5-(4-fluorophenyl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
3-[[4-(2-aminopyrimidin-4-yl)-5-(4-fluorophenyl)-1H-imidazol-2-yl]methyl]benzonitrile
Q16539
-
3-[[4-(4-fluorophenyl)-5-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
3-[[4-(4-fluorophenyl)-5-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
3-[[4-(4-fluorophenyl)-5-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
3-[[4-(4-fluorophenyl)-5-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
3-[[4-(4-fluorophenyl)-5-[2-[(4-methoxybenzyl)amino]pyrimidin-4-yl]-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
3-[[5-(2-aminopyrimidin-4-yl)-4-(4-fluorophenyl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
3-[[5-(2-aminopyrimidin-4-yl)-4-(4-fluorophenyl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
3-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
3-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
3-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-2-yl]methyl]benzamide
Q16539
-
3-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-2-yl]methyl]benzonitrile
Q16539
-
3-[[5-(4-fluorophenyl)-4-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
3-[[5-(4-fluorophenyl)-4-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
3-[[5-(4-fluorophenyl)-4-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-2-yl]methyl]benzamide
Q16539
-
3-[[5-(4-fluorophenyl)-4-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-2-yl]methyl]benzonitrile
Q16539
-
3-[[5-(4-fluorophenyl)-4-[2-[(4-methoxybenzyl)amino]pyrimidin-4-yl]-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
3-[[5-(4-fluorophenyl)-4-[2-[(4-methoxybenzyl)amino]pyrimidin-4-yl]-1H-imidazol-2-yl]methyl]benzonitrile
Q16539
-
4-(2,3-dihydro-1,4-benzodioxin-6-yl)-5-[(5-nitro-1,3,4-thiadiazol-2-yl)sulfanyl]-4H-1,2,4-triazol-3-ol
-
-
4-(4-(4-fluorophenyl)-1-methyl-2-(methylsulfanyl)-1H-imidazol-5-yl)-N-[(1S)-1-phenylethyl]pyridin-2-amine
-
-
4-([4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)cyclohexanol
-
-
4-bromo-N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]-1,3-thiazole-2-carboxamide
-
-
4-chloro-3-[[1-(2-chlorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-N-cyclopropylbenzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]oxy]benzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(2,5-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(2,6-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(2,6-difluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(3-fluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(4-fluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(4-fluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
4-[(1H-benzimidazol-2-ylsulfanyl)methyl]benzoic acid
-
-
4-[2-(benzylsulfanyl)-4-(4-fluorophenyl)-1H-imidazol-5-yl]-2-chloropyridine
-
-
4-[2-(benzylsulfanyl)-4-(4-fluorophenyl)-1H-imidazol-5-yl]-2-fluoropyridine
-
-
4-[2-(benzylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]-2-fluoropyridine
-
-
4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]-N-(1,2,3,4-tetrahydronaphthalen-1-yl)pyridin-2-amine
-
-
4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]-N-(1-phenylethyl)pyridin-2-amine
-
-
4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]-N-(2-phenylethyl)pyridin-2-amine
-
-
4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]-N-(thiophen-2-ylmethyl)pyridin-2-amine
-
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-(1-methylethyl)pyrimidin-2-amine
-
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-(1-methylpiperidin-4-yl)pyrimidin-2-amine
-
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-cyclohexylpyrimidin-2-amine
-
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-cyclopentylpyrimidin-2-amine
-
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-cyclopropylpyrimidin-2-amine
-
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-methylpyrimidin-2-amine
-
-
4-[3-amino-4-(2,4-difluorobenzoyl)-1-oxidopyridin-2-yl]-3-methyl-N-(2-morpholin-4-ylethyl)benzamide
-
-
4-[3-amino-4-(2,4-difluorobenzoyl)-1-oxidopyridin-2-yl]-3-methylbenzoic acid
-
-
4-[3-amino-4-(2,4-difluorobenzoyl)-1-oxidopyridin-2-yl]-N-(2-methoxyethyl)-3-methylbenzamide
-
-
4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(tetrahydro-2H-pyran-4-yl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-phenylpyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-[(1R)-1-phenylethyl]pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-[(1S)-1-phenylethyl]pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-1-methyl-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1-phenylethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-1-methyl-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-[(1R)-1-phenylethyl]pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-2-(1-phenylethoxy)pyridine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-2-(4-methylphenoxy)pyridine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-2-(tetrahydrofuran-2-ylmethoxy)pyridine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-2-(thiophen-2-ylmethoxy)pyridine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1,2,2-trimethylpropyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1,2,3,4-tetrahydronaphthalen-1-yl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1-methyl-3-phenylpropyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1-phenylethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1-phenylpropyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(2-methylbutyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(2-methylcyclohexyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(2-phenylpropyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(2-thiophen-2-ylethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(3-methylbutyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(4-methylcyclohexyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(furan-2-ylmethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(naphthalen-1-ylmethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(pyridin-2-ylmethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(pyridin-3-ylmethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(pyridin-4-ylmethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(tetrahydro-2H-pyran-4-yl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(tetrahydrofuran-2-ylmethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(thiophen-2-ylmethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-[(5-methylfuran-2-yl)methyl]pyridin-2-amine
-
-
4-[[(6-amino-9H-purin-8-yl)sulfanyl]methyl]benzoic acid
-
-
4-[[4-(4-fluorophenyl)-5-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
4-[[4-(4-fluorophenyl)-5-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
4-[[4-(4-fluorophenyl)-5-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
4-[[4-(4-fluorophenyl)-5-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
4-[[5-(4-fluorophenyl)-4-(2-hydroxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
4-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
4-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
4-[[5-(4-fluorophenyl)-4-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
5,6-dichloro-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole
-
-
5-(5-nitrothiazol-2-ylthio)-N-((tetrahydrofuran-2-yl)methyl)-1,3,4-thiadiazol-2-amine
-
-
5-(5-nitrothiazol-2-ylthio)-N-propyl-1,3,4-thiadiazol-2-amine
-
-
5-(acetylamino)-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
-
5-(difluoromethyl)-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
-
5-benzyl-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
-
5-bromo-N-(3-chloro-2-piperazin-1-ylphenyl)furan-2-carboxamide
-
-
5-bromo-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
-
5-bromo-N-[2-(4-prop-2-en-1-ylpiperazin-1-yl)-3-(trifluoromethyl)phenyl]furan-2-carboxamide
-
-
5-bromo-N-[2-(4-prop-2-en-1-ylpiperazin-1-yl)biphenyl-3-yl]furan-2-carboxamide
-
-
5-bromo-N-[3-(phenylamino)-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
-
5-bromo-N-[3-bromo-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
-
5-bromo-N-[3-chloro-2-(4-cyclopropylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
-
5-bromo-N-[3-chloro-2-(4-ethylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
-
5-bromo-N-[3-chloro-2-(4-methylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
-
5-bromo-N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
-
5-bromo-N-[3-chloro-2-(4-prop-2-yn-1-ylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
-
5-bromo-N-[3-chloro-2-(4-propylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
-
5-bromo-N-[3-chloro-2-(4-pyridin-2-ylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
-
5-bromo-N-[3-chloro-2-[4-(1-methylethyl)piperazin-1-yl]phenyl]furan-2-carboxamide
-
-
5-bromo-N-[3-chloro-2-[4-(2-methylprop-2-en-1-yl)piperazin-1-yl]phenyl]furan-2-carboxamide
-
-
5-bromo-N-[3-chloro-2-[4-(2-phenylethyl)piperazin-1-yl]phenyl]furan-2-carboxamide
-
-
5-bromo-N-[3-chloro-2-[4-(furan-2-ylmethyl)piperazin-1-yl]phenyl]furan-2-carboxamide
-
-
5-bromo-N-[3-chloro-2-[4-(trifluoroacetyl)piperazin-1-yl]phenyl]furan-2-carboxamide
-
-
5-bromo-N-[3-fluoro-2-(4-prop-2-yn-1-ylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
-
5-bromo-N-[3-methyl-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
-
5-chloro-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzothiazole
-
-
5-chloro-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzoxazole
-
-
5-chloro-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
-
5-cyano-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
-
5-methoxy-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzothiazole
-
-
5-methoxy-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole
-
-
5-methyl-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole
-
-
5-nitro-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole
-
-
5-tert-butyl-N-cyclopropyl-2-methoxy-3-[2-[4-(2-morpholin-4-yl-ethoxy)-naphthalen-1-yl]-2-oxo-acetylamino]-benzamide
-
KR-003048
6-(3-(cyclopropylamino)-6-methylbenzo[d]isoxazol-7-yl)-N,N-dimethylphthalazin-1-amine
-
-
6-bromo-N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]pyridine-2-carboxamide
-
-
6-chloro-2-[(4-methyl-5-thiophen-2-yl-4H-1,2,4-triazol-3-yl)sulfanyl]-1,3-benzothiazole
-
-
6-chloro-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzothiazole
-
-
6-chloro-2-[[4-(2,3-dihydro-1,4-benzodioxin-6-yl)-5-methyl-4H-1,2,4-triazol-3-yl]sulfanyl]-1,3-benzothiazole
-
-
6-chloro-2-[[5-(2,4-dichlorophenyl)-4-methyl-4H-1,2,4-triazol-3-yl]sulfanyl]-1,3-benzothiazole
-
-
6-chloro-2-[[5-(2-methoxyphenyl)-4-phenyl-4H-1,2,4-triazol-3-yl]sulfanyl]-1,3-benzothiazole
-
-
6-chloro-N-cyclopropyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isoxazol-3-amine
-
-
6-chloro-N-isopropyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isoxazol-3-amine
-
-
6-ethoxy-1,3-benzothiazole-2-sulfonamide
-
-
6-ethoxy-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzothiazole
-
-
6-methyl-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzoxazole
-
-
6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)-1H-indazol-3-amine
-
-
6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isothiazol-3-amine
-
-
6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isoxazol-3-amine
-
-
6-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-9H-purin-2-amine
-
-
6-[5-[(6-chloro-1,3-benzothiazol-2-yl)sulfanyl]-4-methyl-4H-1,2,4-triazol-3-yl]quinoline
-
-
7-(1-isopropoxyphthalazin-6-yl)-N,6-dimethylbenzo[d]isoxazol-3-amine
-
-
7-(1-isopropylphthalazin-6-yl)-N,6-dimethylbenzo[d]isoxazol-3-amine
-
-
7-(6-N-phenylaminohexyl)amino-2H-anthra[1,9-cd]pyrazol-6-one
-
AV-7
8-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-9H-purin-6-amine
-
-
adalimumab
-
-
-
alsterpaullone
-
inhibition of JNK/SAPK1c, SAPK2a/p38, SAPK2b/p38beta, SAPK3/p38gamma, and SAPK4/p38delta
AZD6244
-
ARRY-142886, MEK1/2 inhibitor
BIRB 796
BIRB-796
BIRB796
-
-
C2-alkylaminothiazole
-
-
calcium diphosphate
-
crystals in plasma inhibit the p38 MAP kinase mediating the activation of neutrophils and repression of TNF-alpha-induced apoptosis
Cl-1040
-
a potent inhibitor of MEK
ethyl 1-[5-([5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]carbamoyl)-2-methylphenyl]-2,3-dihydro-1H-1,2,3-triazole-4-carboxylate
-
-
FR180204
-
ERK inhibitor, 5-(2-phenyl-pyrazolo[1,5-a]pyridin-3-yl)-1H-pyrazolo[3,4-c]pyridazin-3-ylamine
indirubin-3'-monoxime
-
79% inhibition at 0.01 mM of JNK/SAPK1c, 17% inhibition at 0.01 mM of SAPK2a/p38, 55% inhibition at 0.01 mM of SAPK2b/p38beta, 26% inhibition at 0.01 mM of SAPK3/p38gamma, and 35% inhibition at 0.01 mM of SAPK4/p38delta
kenpaullone
-
slight inhibition of SAPK2a/p38 and SAPK3/p38gamma, no inhibition of SAPK4/p38delta, JNK/SAPK1c, SAPK2b/p38beta, and SAPK4/p38delta
L-790070
-
-
MKK4
-
wild-type MKK4, the D-site from enzyme MKK4 competitively inhibits JNK-mediated phosphorylation of c-Jun and ATF2
-
MKK4 mutant F48K
-
the D-site from enzyme MKK4 competitively inhibits JNK-mediated phosphorylation of c-Jun and ATF2, but to a lesser degree compared to the wild-type MKK4
-
MKK4 mutant L44I
-
the D-site from enzyme MKK4 competitively inhibits JNK-mediated phosphorylation of c-Jun and ATF2
-
ML3375
-
-
ML3403
-
-
Mycophenolic acid
-
-
N,4-dimethyl-3-[2-[(1-methylethyl)amino]-6-oxo-4,6-dihydro-5H-pyrrolo[3,4-d][1,3]thiazol-5-yl]benzamide
-
inhibition of p38alpha MAP kinase
N,4-dimethyl-3-[6-oxo-2-(propylamino)-4,6-dihydro-5H-pyrrolo[3,4-d][1,3]thiazol-5-yl]benzamide
-
inhibition of p38alpha MAP kinase
N,6-dimethyl-7-(1-((R)-3-methylmorpholino)phthalazin-6-yl)-benzo[d]isoxazol-3-amine
-
-
N,6-dimethyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)-benzo[d]isoxazol-3-amine
-
-
N-(1,2-dimethylpropyl)-4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1,2-dimethylpropyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1,2-diphenylethyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1,3-dimethylbutyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1,5-dimethylhexyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1-benzothiophen-2-ylmethyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1-benzyl-2-phenylethyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1-cyclohexylethyl)-4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1-methyl-4-phenylbutyl)-4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1-methylethyl)-4-(1H-pyrazol-4-yl)pyrimidin-2-amine
-
-
N-(1-methylethyl)-4-(3-piperidin-3-yl-1H-pyrazol-4-yl)pyrimidin-2-amine
-
-
N-(1-methylethyl)-4-[3-(6-methylpyridin-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
N-(1-methylethyl)-4-[3-(tetrahydro-2H-pyran-2-yl)-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
N-(1-methylethyl)-4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
N-(1-methylethyl)-4-[3-(tetrahydro-2H-pyran-4-yl)-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
N-(1-methylethyl)-4-[3-[1-(methylsulfonyl)piperidin-4-yl]-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
N-(2,3-dihydro-1H-inden-1-yl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(2-chloro-6-methylphenyl)-2-(cyclobutylamino)-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-(2-chloro-6-methylphenyl)-2-(ethylamino)-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-(2-chloro-6-methylphenyl)-2-(phenylamino)-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-(2-chloro-6-methylphenyl)-2-(propylamino)-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-(2-chloro-6-methylphenyl)-2-[(1-methylethyl)amino]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-(2-methoxyethyl)-5-(5-nitrothiazol-2-ylthio)-1,3,4-thiadiazol-2-amine
-
-
N-(3,3-dimethylbutyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(3,4-dimethoxyphenethyl)-5-(5-nitrothiazol-2-ylthio)-1,3,4-thiadiazol-2-amine
-
-
N-(4-fluorobenzyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(4-methoxybenzyl)-5-(5-nitrothiazol-2-ylthio)-1,3,4-thiadiazol-2-amine
-
-
N-(4-tert-butylbenzyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(5-carbamoyl-2-methylphenyl)-2-(propylamino)-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-(5-carbamoyl-2-methylphenyl)-2-[(1-methylethyl)amino]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-(6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)-benzo[d]isoxazol-3-yl)acetamide
-
-
N-(cyclohexylmethyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(furan-2-ylmethyl)-4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(S)-sec-butyl-6-(6-methyl-3-(methylamino)benzo[d]isoxazol-7-yl)phthalazin-1-amine
-
-
N-benzyl-4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-benzyl-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-cyclohexyl-4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-cyclohexyl-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-cyclopentyl-4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-fluorobenzamide
-
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]oxy]-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-5-fluoro-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]oxy]-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(2,6-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(2,6-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]oxy]-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(3-fluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(4-fluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(4-fluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]oxy]-4-methylbenzamide
-
-
N-cyclopropyl-6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isoxazol-3-amine
-
-
N-cyclopropyl-6-methyl-7-(1-o-tolylphthalazin-6-yl)benzo[d]-isoxazol-3-amine
-
-
N-ethyl-4-methyl-3-[2-[(1-methylethyl)amino]-6-oxo-4,6-dihydro-5H-pyrrolo[3,4-d][1,3]thiazol-5-yl]benzamide
-
inhibition of p38alpha MAP kinase
N-ethyl-4-methyl-3-[6-oxo-2-(propylamino)-4,6-dihydro-5H-pyrrolo[3,4-d][1,3]thiazol-5-yl]benzamide
-
inhibition of p38alpha MAP kinase
N-ethyl-5-(5-nitrothiazol-2-ylthio)-1,3,4-thiadiazol-2-amine
-
-
N-ethyl-6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isoxazol-3-amine
-
-
N-isopropyl-6-(6-methyl-3-(methylamino)benzo[d]isoxazol-7-yl)phthalazin-1-amine
-
-
N-sec-butyl-5-(5-nitrothiazol-2-ylthio)-1,3,4-thiadiazol-2-amine
-
-
N-[(1R)-1-cyclohexylethyl]-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-[(1S)-1-(3-chloro-4-fluorophenyl)-2-hydroxyethyl]-4-[4-(3-chlorophenyl)-1H-pyrazol-3-yl]-1H-pyrrole-3-carboxamide
-
-
N-[(1S)-1-cyclohexylethyl]-4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-[(1S)-1-cyclohexylethyl]-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]-5-(phenylamino)furan-2-carboxamide
-
-
N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]-5-ethylfuran-2-carboxamide
-
-
N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]-5-fluorofuran-2-carboxamide
-
-
N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]-5-methoxyfuran-2-carboxamide
-
-
N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]-5-methylfuran-2-carboxamide
-
-
N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]-5-prop-1-yn-1-ylfuran-2-carboxamide
-
-
N-[2-(2,5-dimethylphenyl)ethyl]-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-[2-(4-acetylpiperazin-1-yl)-3-chlorophenyl]-5-bromofuran-2-carboxamide
-
-
N-[2-(4-benzylpiperazin-1-yl)-3-chlorophenyl]-5-bromofuran-2-carboxamide
-
-
N-[2-methyl-5-(methylcarbamoyl)phenyl]-2-(propylamino)-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-[2-methyl-5-(methylcarbamoyl)phenyl]-2-[[(1S)-1-methylpropyl]amino]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]-1,3-thiazole-4-carboxamide
-
-
N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]-1H-pyrrole-2-carboxamide
-
-
N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]-2-methyl-1,3-thiazole-4-carboxamide
-
-
N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]-5-cyanopyridine-2-carboxamide
-
-
N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]-6-methylpyridine-2-carboxamide
-
-
N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]isoxazole-5-carboxamide
-
-
N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]pyrimidine-2-carboxamide
-
-
N-[5-(ethylcarbamoyl)-2-methylphenyl]-2-(propylamino)-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-[5-(ethylcarbamoyl)-2-methylphenyl]-2-[(1-methylethyl)amino]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-[5-(ethylcarbamoyl)-2-methylphenyl]-4-methyl-2-(propylamino)-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-[5-(isoxazol-3-ylcarbamoyl)-2-methylphenyl]-2-[(1-methylethyl)amino]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-(4-[N-[(1R)-1-cyclohexylethyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-(4-[N-[(1S)-1-cyclohexylethyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-(4-[N-[(1S)-2-(dimethylamino)-1-phenylethyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-(4-[N-[2-(dimethylamino)-2-methylpropyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-(4-[N-[3-(dimethylamino)-2,2-dimethylpropyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-[4-(N-cyclopropylglycyl)-2,3-dihydro-1H-1,2,3-triazol-1-yl]-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-[4-[N-(2,2-dimethylpropyl)glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl]-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-[4-[N-(2-hydroxy-2-methylpropyl)glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl]-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-[4-[N-(cyclohexylmethyl)glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl]-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-(4-[N-[(1-methylpiperidin-3-yl)methyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)benzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-(4-[N-[(1-methylpiperidin-4-yl)methyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)benzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-(4-[N-[(1R)-1,2,2-trimethylpropyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)benzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-(4-[N-[(1R)-1-phenylethyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)benzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-(4-[N-[(1S)-1,2,2-trimethylpropyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)benzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-(4-[N-[(1S)-1-phenylethyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)benzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-[4-(N-methylglycyl)-2,3-dihydro-1H-1,2,3-triazol-1-yl]benzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-[4-[N-(pyridin-3-ylmethyl)glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl]benzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-[4-[N-(pyridin-4-ylmethyl)glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl]benzamide
-
-
N-[trans-4-([4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)cyclohexyl]acetamide
-
-
N-[trans-4-([4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)cyclohexyl]methanesulfonamide
-
-
panduratin A
-
-
PD098059
-
selective inhibitor of mitogen-activated extracellular regulated kinase phosphorylation, arrests cells in G(0)/G(1), increases P21/waf1 antigen expression
PD169316
Q16539
-
PD98059
pep-JIP1
-
peptide corresponding to the D-domain of JIP-1, final sequence of the most extensively used peptide is GRKKRRQRRRPPRPKRPTTLNLFPQVPRSQDT
purvalanol
-
16% inhibition at 0.01 mM of JNK/SAPK1c, no inhibition of SAPK2a/p38, SAPK3/p38gamma, and SAPK4/p38delta
RWJ67657
-
-
S-1,3-benzothiazol-2-yl (2Z)-(2-amino-1,3-thiazol-4-yl)(methoxyimino)ethanethioate
-
-
SB 203580
-
no preference for either active or inactive p38alpha, no preincubation required to achieve maximum inhibition
SB202
-
p38 inhibitor SB202
SB202190
SB203580
SB203580-iodo
Q16539
-
SB203580-sulfone
Q16539
-
SB220025
Q16539
-
SB239063
-
-
SB242235
SC68376
Q16539
-
SCIO-469
Q16539
-
SKF86002
Q16539
-
SP600125
SR3451
-
-
SR3576
-
-
SR3582
-
-
SR3583
-
-
SR4018
-
-
SR4276
-
-
SR4326
-
-
SR4642
-
-
SR4643
-
-
TAK-715
Q16539
-
tert-butyl 4-(2-[[(5-bromofuran-2-yl)carbonyl]amino]-6-chlorophenyl)piperazine-1-carboxylate
-
-
trans-4-([4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)cyclohexanol
-
-
trans-4-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)cyclohexanol
-
-
trans-4-[(4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridin-2-yl)amino]cyclohexanol
-
-
U0126
VX-702
Q16539
-
[3-amino-2-(1,3-benzodioxol-4-yl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[3-amino-2-(2,3-dimethoxyphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[3-amino-2-(2,4-difluorophenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[3-amino-2-(2,6-dichlorophenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[3-amino-2-(2,6-difluoro-4-methoxyphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[3-amino-2-(2,6-difluorophenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[3-amino-2-(2,6-dimethoxyphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[3-amino-2-(2,6-dimethylphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[3-amino-2-(2-chlorophenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[3-amino-2-(2-chlorophenyl)-1-oxidopyridin-4-yl](2-chlorophenyl)methanone
-
-
[3-amino-2-(2-chlorophenyl)-1-oxidopyridin-4-yl](2-methoxyphenyl)methanone
-
-
[3-amino-2-(2-chlorophenyl)-1-oxidopyridin-4-yl](2-trifluoromethylphenyl)methanone
-
-
[3-amino-2-(2-chlorophenyl)-1-oxidopyridin-4-yl](phenyl)methanone
-
-
[3-amino-2-(2-isopropylphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[3-amino-2-(2-methoxyphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[3-amino-2-(2-methylphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[3-amino-2-(2-methylphenyl)-1-oxidopyridin-4-yl](phenyl)methanone
-
-
[3-amino-2-(3-chlorophenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[3-amino-2-(4-chloro-2-methylphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[3-amino-2-(4-chlorophenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[3-amino-2-(4-chlorophenyl)-1-oxidopyridin-4-yl](phenyl)methanone
-
-
[3-amino-2-(4-hydroxy-2-methylphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[3-amino-2-[2-methyl-4-(2-morpholin-4-ylethoxy)phenyl]-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[3-amino-2-[4-(2-methoxyethoxy)-2-methylphenyl]-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
[Nle4, D-Phe7]alpha-melanocyte stimulating hormone
-
NDP-MSH, the melanocortin agonist dose-dependently inhibits JNK activity in HEK-293 cells stably expressing the human melanocortin receptor type 4
-
additional information
-
ACTIVATING COMPOUND
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
amitriptyline
-
up-regulates ERK1/2 phosphorylation and activity 8fold at 0.01 mM, the addition of nor-binaltorphimine (100 nM) reduces the amitriptyline stimulatory effect by 70%
citrinin
-
the exposure of HEK-293 and HeLa cells to citrinin results in a dose-dependent increase in the phosphorylation of ERK1/2 and JNK
cytokines
-
glucocorticoids
-
activate p38 MAPK, e.g. by induction of activating MKK3
-
interleukin-1beta
-
activates the MAPKs, dexamethasone inhibits this activation
-
interleukin-I
-
-
-
lipopolysaccharide
-
-
mitogen-activated protein kinase kinase 6
-
MKK6
-
MKK3
-
MKK6
-
mycosporine-glycine
-
mycosporine-like amino acids shinorine, mycosporine-glycine, and porphyra are purified from Chlamydomonas hedlyei and Porphyra yezoensis activate kinase ERK and JNK, especially JNK
porphyra
-
mycosporine-like amino acids shinorine, mycosporine-glycine, and porphyra are purified from Chlamydomonas hedlyei and Porphyra yezoensis activate kinase ERK and JNK, especially JNK
Porphyromonas gingivalis supernatant
-
-
-
purvalanol
-
17% activation of SAPK2b/p38beta
Ras
-
Ras induces phosphorylation of c-Jun by JNKs
-
shinorine
-
mycosporine-like amino acids shinorine, mycosporine-glycine, and porphyra are purified from Chlamydomonas hedlyei and Porphyra yezoensis activate kinase ERK and JNK, especially JNK
temozolomide
-
-
thapsigargin
-
stimulates 4-5fold the expression of p44/p42
TNF-alpha
-
transforming growth factor-beta
-
i.e. TGF-beta, activates p38, butenoside inhibits this activation
-
tumor necrosis factor-alpha
-
-
-
additional information
-