BRENDA - Enzyme Database show
show all sequences of

Discovery of 2-(5-nitrothiazol-2-ylthio)benzo[d]thiazoles as novel c-Jun N-terminal kinase inhibitors

De, S.K.; Chen, L.H.; Stebbins, J.L.; Machleidt, T.; Riel-Mehan, M.; Dahl, R.; Chen, V.; Yuan, H.; Barile, E.; Emdadi, A.; Murphy, R.; Pellecchia, M.; Bioorg. Med. Chem. 17, 2712-2717 (2009)

Data extracted from this reference:

Activating Compound
Activating Compound
additional information
activated by a range of stress stimuli, such as heat shock, irradiation, hypoxia, chemotoxins, and peroxides, also activated in response to various cytokines
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole-5-sulfonic acid
Homo sapiens
Homo sapiens
Homo sapiens
4-[(1H-benzimidazol-2-ylsulfanyl)methyl]benzoic acid
Homo sapiens
4-[[(6-amino-9H-purin-8-yl)sulfanyl]methyl]benzoic acid
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
peptide corresponding to the D-domain of JIP-1, final sequence of the most extensively used peptide is GRKKRRQRRRPPRPKRPTTLNLFPQVPRSQDT
Homo sapiens
S-1,3-benzothiazol-2-yl (2Z)-(2-amino-1,3-thiazol-4-yl)(methoxyimino)ethanethioate
Homo sapiens
Natural Substrates/ Products (Substrates)
Natural Substrates
Commentary (Nat. Sub.)
Natural Products
Commentary (Nat. Pro.)
Organism (Nat. Pro.)
ATP + a protein
Homo sapiens
ADP + a phosphoprotein
Primary Accession No. (UniProt)
Homo sapiens
Source Tissue
Source Tissue
HeLa cell
Homo sapiens
Substrates and Products (Substrate)
Commentary Substrates
Literature (Substrates)
Commentary (Products)
Literature (Products)
Organism (Products)
ATP + a protein
Homo sapiens
ADP + a phosphoprotein
substrate in in vitro kinase assay, LanthaScreen
Homo sapiens
ADP + phosphorylated ATF2
ATP + c-Jun transcription factor
JNK phosphorylates the N-terminal transactivation domain of c-Jun transcription factor
Homo sapiens
ADP + phosphorylated c-Jun transcription factor
Homo sapiens
IC50 Value
IC50 Value
IC50 Value Maximum
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
larger than 0.050
Homo sapiens
Homo sapiens
larger than 0.050
Homo sapiens
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole-5-sulfonic acid
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
S-1,3-benzothiazol-2-yl (2Z)-(2-amino-1,3-thiazol-4-yl)(methoxyimino)ethanethioate
Homo sapiens
Homo sapiens
4-[[(6-amino-9H-purin-8-yl)sulfanyl]methyl]benzoic acid
larger than 0.100
Homo sapiens
larger than 0.100
Homo sapiens
4-[(1H-benzimidazol-2-ylsulfanyl)methyl]benzoic acid
Activating Compound (protein specific)
Activating Compound
additional information
activated by a range of stress stimuli, such as heat shock, irradiation, hypoxia, chemotoxins, and peroxides, also activated in response to various cytokines
Homo sapiens
Cofactor (protein specific)
Homo sapiens
IC50 Value (protein specific)
IC50 Value
IC50 Value Maximum
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
larger than 0.050
Homo sapiens
Homo sapiens
larger than 0.050
Homo sapiens
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole-5-sulfonic acid
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
larger than 0.050
Homo sapiens
S-1,3-benzothiazol-2-yl (2Z)-(2-amino-1,3-thiazol-4-yl)(methoxyimino)ethanethioate
Homo sapiens
Homo sapiens
4-[[(6-amino-9H-purin-8-yl)sulfanyl]methyl]benzoic acid
larger than 0.100
Homo sapiens
larger than 0.100
Homo sapiens
4-[(1H-benzimidazol-2-ylsulfanyl)methyl]benzoic acid
Inhibitors (protein specific)
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole-5-sulfonic acid
Homo sapiens
Homo sapiens
Homo sapiens
4-[(1H-benzimidazol-2-ylsulfanyl)methyl]benzoic acid
Homo sapiens
4-[[(6-amino-9H-purin-8-yl)sulfanyl]methyl]benzoic acid
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
Homo sapiens
peptide corresponding to the D-domain of JIP-1, final sequence of the most extensively used peptide is GRKKRRQRRRPPRPKRPTTLNLFPQVPRSQDT
Homo sapiens
S-1,3-benzothiazol-2-yl (2Z)-(2-amino-1,3-thiazol-4-yl)(methoxyimino)ethanethioate
Homo sapiens
Natural Substrates/ Products (Substrates) (protein specific)
Natural Substrates
Commentary (Nat. Sub.)
Natural Products
Commentary (Nat. Pro.)
Organism (Nat. Pro.)
ATP + a protein
Homo sapiens
ADP + a phosphoprotein
Source Tissue (protein specific)
Source Tissue
HeLa cell
Homo sapiens
Substrates and Products (Substrate) (protein specific)
Commentary Substrates
Literature (Substrates)
Commentary (Products)
Literature (Products)
Organism (Products)
ATP + a protein
Homo sapiens
ADP + a phosphoprotein
substrate in in vitro kinase assay, LanthaScreen
Homo sapiens
ADP + phosphorylated ATF2
ATP + c-Jun transcription factor
JNK phosphorylates the N-terminal transactivation domain of c-Jun transcription factor
Homo sapiens
ADP + phosphorylated c-Jun transcription factor
Homo sapiens
up-regulation of JNK activity is associated with a number of disease states such as type-2 diabetes, obesity, cancer, inflammation, and stroke
Expression (protein specific)
Homo sapiens
up-regulation of JNK activity is associated with a number of disease states such as type-2 diabetes, obesity, cancer, inflammation, and stroke
Other publictions for EC
1st author
Pub Med
Activating Compound
Crystallization (Commentary)
General Stability
KM Value [mM]
Molecular Weight [Da]
Natural Substrates/ Products (Substrates)
Organic Solvent Stability
Oxidation Stability
Posttranslational Modification
Purification (Commentary)
Renatured (Commentary)
Source Tissue
Specific Activity [micromol/min/mg]
Storage Stability
Substrates and Products (Substrate)
Temperature Optimum [°C]
Temperature Range [°C]
Temperature Stability [°C]
Turnover Number [1/s]
pH Optimum
pH Range
pH Stability
Ki Value [mM]
pI Value
IC50 Value
Activating Compound (protein specific)
Application (protein specific)
Cloned(Commentary) (protein specific)
Cofactor (protein specific)
Crystallization (Commentary) (protein specific)
Engineering (protein specific)
General Stability (protein specific)
IC50 Value (protein specific)
Inhibitors (protein specific)
Ki Value [mM] (protein specific)
KM Value [mM] (protein specific)
Localization (protein specific)
Metals/Ions (protein specific)
Molecular Weight [Da] (protein specific)
Natural Substrates/ Products (Substrates) (protein specific)
Organic Solvent Stability (protein specific)
Oxidation Stability (protein specific)
Posttranslational Modification (protein specific)
Purification (Commentary) (protein specific)
Renatured (Commentary) (protein specific)
Source Tissue (protein specific)
Specific Activity [micromol/min/mg] (protein specific)
Storage Stability (protein specific)
Substrates and Products (Substrate) (protein specific)
Subunits (protein specific)
Temperature Optimum [°C] (protein specific)
Temperature Range [°C] (protein specific)
Temperature Stability [°C] (protein specific)
Turnover Number [1/s] (protein specific)
pH Optimum (protein specific)
pH Range (protein specific)
pH Stability (protein specific)
pI Value (protein specific)
General Information
General Information (protein specific)
Expression (protein specific)
KCat/KM [mM/s]
KCat/KM [mM/s] (protein specific)
Substrate thiophosphorylation ...
Arabidopsis thaliana
BMC Plant Biol.
Essential role of mitogen-acti ...
Homo sapiens
BMC Res. Notes
Molecular basis of the interac ...
Homo sapiens
J. Biol. Chem.
Context specificity of stress- ...
Caenorhabditis elegans
J. Biol. Chem.
Structure-based assignment of ...
Rattus norvegicus
Role of p38 mitogen-activated ...
Mus musculus
Two hydrophobic residues can d ...
Homo sapiens, Mus musculus
J. Biol. Chem.
Mycosporine-like amino acids p ...
Homo sapiens
Mar. Drugs
The Arabidopsis mitogen-activa ...
Arabidopsis thaliana
New Phytol.
The Arabidopsis transcription ...
Arabidopsis thaliana, Arabidopsis thaliana Col-0
Plant Physiol.
Epidermal growth factor-mediat ...
Ovis aries
Mitogen-activated protein kina ...
Fusarium oxysporum f. cubense, Fusarium oxysporum f. cubense XJZ2
The role of Mitogen-Activated ...
Bipolaris sorokiniana, Bipolaris sorokiniana ND90Pr
Genome-wide identification and ...
Musa acuminata
Funct. Integr. Genomics
The mitogen-activated protein ...
Homo sapiens
J. Biol. Chem.
The p38beta mitogen-activated ...
Homo sapiens
J. Biol. Chem.
Mitogen-activated protein kina ...
Arabidopsis thaliana, Arabidopsis thaliana Col-0
J. Plant Physiol.
Structural basis for the regul ...
Homo sapiens
J. Biol. Chem.
MG132, a proteasome inhibitor, ...
Rattus norvegicus
Acta Biochim. Biophys. Sin. (Shanghai)
Efficient inhibition of the fo ...
Rattus norvegicus
Biochem. Biophys. Res. Commun.
Part 2: Structure-activity rel ...
Homo sapiens
Bioorg. Med. Chem. Lett.
Synthesis and optimization of ...
Homo sapiens
Bioorg. Med. Chem.
Trisubstituted purines are use ...
Solanum peruvianum
Biosci. Biotechnol. Biochem.
Adalimumab therapy rapidly inh ...
Homo sapiens
Br. J. Dermatol.
KR-003048, a potent, orally ac ...
Homo sapiens
Eur. J. Pharmacol.
Hypericin, the active componen ...
Rattus norvegicus
Eur. J. Pharmacol.
Pyridinylquinoxalines and pyri ...
Mus musculus
J. Med. Chem.
Early undernutrition increases ...
Rattus norvegicus
J. Neurochem.
ERK1/2 mitogen-activated prote ...
Rattus norvegicus
J. Neurosci.
Direct agonist activity of tri ...
Homo sapiens, Rattus norvegicus
J. Pharmacol. Exp. Ther.
da Costa
The role of p38 mitogen-activa ...
Homo sapiens
Leuk. Res.
Increased cell proliferation a ...
Rattus norvegicus
Effect of cyclin-dependent kin ...
Bos taurus
Reprod. Domest. Anim.
Inhibition of gap-junctional i ...
Rattus norvegicus
Activation of ERK and JNK sign ...
Homo sapiens
Toxicol. Appl. Pharmacol.
A p38 mitogen-activated protei ...
Homo sapiens
Anal. Biochem.
Inhibition of c-Jun N-terminal ...
Mus musculus
Biochem. Biophys. Res. Commun.
Glucocorticoids and mitogen- a ...
Mus musculus
Biochem. Pharmacol.
Inhibitory effect of pandurati ...
Homo sapiens
Biol. Pharm. Bull.
Synthesis and SAR of 4-substit ...
Homo sapiens
Bioorg. Med. Chem. Lett.
Synthesis and SAR of piperazin ...
Homo sapiens
Bioorg. Med. Chem. Lett.
Discovery of 2-(5-nitrothiazol ...
Homo sapiens
Bioorg. Med. Chem.
Characterization of a novel mi ...
Homo sapiens
Cancer Res.
Cobalt protoporphyrin inhibiti ...
Mus musculus
Chem. Biol. Interact.
In vitro and in vivo radiosens ...
Homo sapiens
Clin. Cancer Res.
The GluR2 subunit inhibits pro ...
Homo sapiens
Eur. J. Neurosci.
Nobiletin, a dietary phytochem ...
Bos taurus
Eur. J. Pharmacol.
Single low-dose administration ...
Rattus norvegicus
Eur. J. Pharmacol.
A selective small-molecule inh ...
Homo sapiens, Mus musculus
FEBS Lett.
Structure-activity relationshi ...
Homo sapiens, Mammalia
J. Biol. Chem.
Echographic detection of dieth ...
Rattus norvegicus
J. Gastroenterol. Hepatol.
Aza-analogue dibenzepinone sca ...
J. Med. Chem.
Design, synthesis, and structu ...
J. Med. Chem.
Design, synthesis, and structu ...
Homo sapiens
J. Med. Chem.
Structure-guided design of pot ...
Homo sapiens
J. Med. Chem.
3,4-Diaryl-isoxazoles and -imi ...
Mus musculus
J. Med. Chem.
Inhibition of c-Jun N-terminal ...
Homo sapiens
J. Neurooncol.
Anti-inflammatory properties o ...
Homo sapiens
J. Pharmacol. Exp. Ther.
Melanocortin-4 receptor activa ...
Homo sapiens
Identity of an ABA-activated 4 ...
Zea mays
Mycophenolic acid inhibits p38 ...
Homo sapiens
Transplant. Proc.
Trauma-hemorrhage inhibits spl ...
Mus musculus
Am. J. Physiol. Cell Physiol.
ATLAS - a high-throughput affi ...
Homo sapiens
Assay Drug Dev. Technol.
Characterization and inhibitio ...
Echinococcus multilocularis
Biochem. Pharmacol.
The discovery of (R)-2-(sec-bu ...
Homo sapiens
Bioorg. Med. Chem. Lett.
Benzothiazole based inhibitors ...
Rattus norvegicus
Bioorg. Med. Chem. Lett.
Structure-based design and sub ...
Homo sapiens
Bioorg. Med. Chem. Lett.
Synthesis and biological evalu ...
Homo sapiens
Bioorg. Med. Chem. Lett.
Reverse alpha-ketoamide-based ...
Homo sapiens
Bioorg. Med. Chem. Lett.
Inhibition of toll-like recept ...
Mus musculus
Clin. Exp. Pharmacol. Physiol.
p38alpha MAPK inhibits JNK act ...
Mus musculus, Mus musculus C57BL/6
Cadmium activates the mitogen- ...
Homo sapiens, Rattus norvegicus
Free Radic. Biol. Med.
Signaling pathway for TNF-alph ...
Homo sapiens
Int. Immunopharmacol.
Cell-specific activation profi ...
Homo sapiens
J. Allergy Clin. Immunol.
Enzymatic activity and substra ...
Mus musculus
J. Biol. Chem.
Control of MAP kinase specific ...
Saccharomyces cerevisiae
J. Biol. Chem.
Oxidative stress-induced inhib ...
Mus musculus
J. Endocrinol.
Novel human neutrophil agonist ...
Homo sapiens
J. Leukoc. Biol.
Design, synthesis, and biologi ...
Homo sapiens
J. Med. Chem.
3-amino-7-phthalazinylbenzoiso ...
Homo sapiens
J. Med. Chem.
The crystal structure of JNK2 ...
Homo sapiens
J. Mol. Biol.
Inhibitors of p38 mitogen-acti ...
Mus musculus
J. Neurosci. Res.
Characterization of PsMPK2, th ...
Pisum sativum
Using engineered scaffold inte ...
Saccharomyces cerevisiae
Multimodal signaling by the AD ...
Rattus norvegicus
Exp. Neurol.
Use of docking peptides to des ...
synthetic construct
ACS Chem. Biol.
High-resolution diffracting cr ...
Mus musculus
Acta Crystallogr. Sect. D
Specific inhibitors of mitogen ...
Biomphalaria glabrata, Lymnaea stagnalis
Dev. Comp. Immunol.
Specific inhibition of basal m ...
Homo sapiens
Exp. Hematol.
ter Haar
Crystal structure of the p38 a ...
Homo sapiens
J. Biol. Chem.
The MAP kinase JNK-1 of Caenor ...
Caenorhabditis elegans
J. Cell. Physiol.
Cloning and characterisation o ...
Salmo salar, Salmo salar Aquagen standard
Mol. Immunol.
Crystal structure of the MAP k ...
Homo sapiens
Protein Sci.
Enzyme fragment complementatio ...
Homo sapiens
Assay Drug Dev. Technol.
Characterization of mitogen-ac ...
Homo sapiens
MAP-ping genomic organization ...
Populus trichocarpa
BMC Genet.
Mps1 phosphorylation by MAP ki ...
Xenopus laevis
Curr. Biol.
Analysis of mitogen-activated ...
Saccharomyces cerevisiae
Eukaryot. Cell
Control of Borrelia burgdorfer ...
Mus musculus, Mus musculus C3H/HEN
Infect. Immun.
Characterisation of EmMPK1, an ...
Echinococcus multilocularis
Int. J. Parasitol.
A specific mechanomodulatory r ...
Gallus gallus, Rattus norvegicus
J. Biol. Chem.
Characterization of a mitogen- ...
Cucumis sativus
Plant Physiol.
MAPK signal specificity: the r ...
Rattus norvegicus, Xenopus sp.
Trends Biochem. Sci.
Characterization of serotonin ...
Homo sapiens
J. Neurochem.
Following in vitro activation ...
Homo sapiens
Anal. Biochem.
Identification and characteriz ...
Mus musculus
Phosphatidylserine-specific re ...
Mus musculus
Biol. Pharm. Bull.
The Gpmk1 MAP kinase of Fusari ...
Fusarium graminearum 08. Jan, Fusarium graminearum
Curr. Genet.
The MAP kinase substrate MKS1 ...
Arabidopsis thaliana
Kinetic mechanism for p38 MAP ...
Mus musculus
Activation mechanisms of endot ...
Rattus norvegicus
Free Radic. Res.
Nuclear localization and mitog ...
Homo sapiens, Mesocricetus auratus
J. Biol. Chem.
Retinoid signaling regulates C ...
Gallus gallus
J. Bone Miner. Res.
A role for p38 mitogen-activat ...
Rattus norvegicus
J. Neurosci.
Ceramide activates a mitochond ...
Gallus gallus
Mol. Cell. Biochem.
p38 Mitogen-activated protein ...
Homo sapiens
Mol. Endocrinol.
Principles of MAP kinase signa ...
Saccharomyces cerevisiae
Annu. Rev. Genet.
Specificity of the MAP kinase ...
Rattus norvegicus
Arch. Biochem. Biophys.
Mechanical pressure-induced ph ...
Homo sapiens
Biochem. Biophys. Res. Commun.
Calcium pyrophosphate dihydrat ...
Homo sapiens
Cell. Signal.
Characterization of active mit ...
Homo sapiens
Clin. Cancer Res.
Regulatory mechanisms and func ...
Danio rerio, vertebrata
J. Biochem.
Identification of phospholipas ...
Rattus norvegicus
J. Biol. Chem.
MAP kinases as structural adap ...
Mammalia, Saccharomyces cerevisiae
J. Cell Sci.
A novel mechanism for mitogen- ...
Rattus norvegicus
Mol. Biol. Cell
Heavy metal stress. Activation ...
Medicago sativa
Plant Physiol.
Differentiation stage-specific ...
Homo sapiens
Proc. Natl. Acad. Sci. USA
Improved expression, purificat ...
Mus musculus
Protein Expr. Purif.
Adams Joseph
Activation loop phosphorylatio ...
The specificities of protein k ...
Homo sapiens, Mus musculus
Biochem. J.
Signalling specificity of Ser/ ...
Homo sapiens
Biochem. J.
Mitogen-activated protein kina ...
Homo sapiens
Curr. Med. Chem.
Evidence for antagonism of BMP ...
Xenopus laevis
TmkA, a mitogen-activated prot ...
Trichoderma virens
Eukaryot. Cell
Mechanism of p38 MAP kinase ac ...
Mus musculus
Genes Dev.
Mitogen-activated protein kina ...
Canis lupus familiaris, Homo sapiens, Mus musculus, Oryctolagus cuniculus, Rattus norvegicus, Sus scrofa
Mol. Cell. Biochem.
Structural basis for p38alpha ...
Mus musculus
Nat. Struct. Biol.
The genome sequence of Schizos ...
Schizosaccharomyces pombe
JNK signaling pathway is requi ...
Drosophila melanogaster
Dev. Biol.
JNK functions in the non-canon ...
Xenopus laevis
Kinetic and catalytic mechanis ...
Chem. Rev.
A novel method to identify pro ...
Homo sapiens
UNC-16, a JNK-signaling scaffo ...
Caenorhabditis elegans
Requirement of the JIP1 scaffo ...
Mus musculus
Genes Dev.
Cystic fibrosis pathogens acti ...
Homo sapiens
J. Biol. Chem.
Sequence and analysis of chrom ...
Arabidopsis thaliana
The genome sequence of Drosoph ...
Drosophila melanogaster
ERK1b, a 46-kDa ERK isoform th ...
Rattus norvegicus
J. Biol. Chem.
Synergistic activation of stre ...
Homo sapiens
Biochem. J.
Cloning and characterization o ...
Mus musculus
Biochem. J.
JNK is required for effector T ...
Mus musculus
Asymmetric p38 activation in z ...
Danio rerio
J. Cell. Biol.
Identification of a nuclear ex ...
Cyprinus carpio
Eur. J. Biochem.
Analysis of yeast protein kina ...
Saccharomyces cerevisiae
Nat. Genet.
The DNA sequence of human chro ...
Homo sapiens
Sequence and analysis of chrom ...
Arabidopsis thaliana
Murine p38-delta mitogen-activ ...
Homo sapiens, Rattus norvegicus
J. Biol. Chem.
Structure and polymorphism of ...
Homo sapiens, Pan troglodytes
DNA Seq.
Differential expression and ac ...
Homo sapiens
J. Immunol.
An exploration of the sequence ...
Drosophila melanogaster
P38 mitogen-activated protein ...
Drosophila melanogaster
Mol. Cell. Biol.
Thorax closure in Drosophila: ...
Drosophila melanogaster
JSAP1, a novel jun N-terminal ...
Mus musculus
Mol. Cell. Biol.
A Caenorhabditis elegans JNK s ...
Caenorhabditis elegans
A conserved p38 mitogen-activa ...
Drosophila melanogaster
Mol. Cell. Biol.
Molecular cloning and characte ...
Drosophila melanogaster
J. Biol. Chem.
Stimulation of 'stress-regulat ...
Rattus norvegicus
J. Biol. Chem.
Selective activation of p38 mi ...
Homo sapiens
J. Biol. Chem.
Molecular cloning and characte ...
Homo sapiens
J. Biol. Chem.
Novel homologues of CSBP/p38 M ...
Homo sapiens
Biochem. Biophys. Res. Commun.
Characterization of the struct ...
Homo sapiens
J. Biol. Chem.
Activation of the novel stress ...
Homo sapiens
Structure and expression of ca ...
Cyprinus carpio
J. Biochem.
Sequence analysis of 203 kilob ...
Saccharomyces cerevisiae
Activation mechanism of the MA ...
Mus musculus
Sequence analysis of a 37.6 kb ...
Saccharomyces cerevisiae
The structure of mitogen-activ ...
Mus musculus
Proc. Natl. Acad. Sci. USA
Drosophila Jun kinase regulate ...
Drosophila melanogaster
Genes Dev.
Cloning and expression of cDNA ...
Fusarium solani, Fusarium solani T8
P38-2, a novel mitogen-activat ...
Homo sapiens
J. Biol. Chem.
Absence of excitotoxicity-indu ...
Mus musculus
Targeted disruption of the MKK ...
Mus musculus
Proc. Natl. Acad. Sci. USA
Mitogen-activated protein kina ...
Mus musculus
Proc. Natl. Acad. Sci. USA
Spm1, a stress-activated MAP k ...
Schizosaccharomyces pombe
Active and inactive protein ki ...
Selective interaction of JNK p ...
Homo sapiens
A JNK signal transduction path ...
Drosophila melanogaster
Genes Dev.
The Drosophila Jun-N-terminal ...
Drosophila melanogaster
Genes Dev.
Conjugation, meiosis, and the ...
Schizosaccharomyces pombe
Genes Dev.
Characterization of the struct ...
Homo sapiens
J. Biol. Chem.
Primary structure, expression ...
Homo sapiens
Developmental expression in th ...
Mus musculus
Brain Res. Mol. Brain Res.
San Jose
The mitogen-activated protein ...
Candida albicans
J. Bacteriol.
MAP kinase and cAMP signaling ...
Magnaporthe grisea
Genes Dev.
The fission yeast pmk1+ gene e ...
Schizosaccharomyces pombe
Mol. Cell. Biol.
Protein kinases and phosphatas ...
Independent human MAP-kinase s ...
Homo sapiens, Mus musculus
P493F12 kinase: a novel MAP ki ...
Homo sapiens
Pyp1 and Pyp2 PTPases dephosph ...
Schizosaccharomyces pombe
Genes Dev.
Components of a new human prot ...
Homo sapiens
J. Biol. Chem.
Primary structure of BMK1: a n ...
Homo sapiens
Biochem. Biophys. Res. Commun.
MMK2, a novel alfalfa MAP kina ...
Medicago sativa
Mol. Gen. Genet.
Molecular cloning, functional ...
Nicotiana tabacum
Eur. J. Biochem.
A homologue of the MAP/ERK fam ...
Petunia x hybrida
Plant Mol. Biol.
Substrate and pseudosubstrate ...
Trends Biochem. Sci.
Complete nucleotide sequence o ...
Saccharomyces cerevisiae
Atomic structure of the MAP ki ...
Mus musculus
Suppression of activated Let-6 ...
Caenorhabditis elegans
Genes Dev.
A MAP kinase homolog, mpk-1, i ...
Caenorhabditis elegans
Genes Dev.
The Drosophila rolled locus en ...
Drosophila melanogaster
SMK1, a developmentally regula ...
Saccharomyces cerevisiae
Genes Dev.
Identification and functional ...
Dictyostelium discoideum
Mol. Cell. Biol.
JNK1: a protein kinase stimula ...
Homo sapiens
Signal transduction by tumor n ...
Homo sapiens
Mol. Cell. Biol.
JNK2 contains a specificity-de ...
Homo sapiens
Genes Dev.
A MAP kinase targeted by endot ...
Mus musculus
A novel kinase cascade trigger ...
Xenopus laevis
The stress-activated protein k ...
Rattus norvegicus
Cloning and characterization o ...
Homo sapiens
Mol. Cell. Biol.
Characterization of two cDNAs ...
Arabidopsis thaliana
Plant J.
Novel CDC2-related protein kin ...
Mus musculus
Molecular cloning, expression, ...
Homo sapiens
Mol. Cell. Biol.
Schizosaccharomyces pombe Spk1 ...
Schizosaccharomyces pombe
Mol. Cell. Biol.
An osmosensing signal transduc ...
Saccharomyces cerevisiae
The SLT2 (MPK1) MAP kinase hom ...
Saccharomyces cerevisiae
J. Cell. Biol.
Molecular cloning and expressi ...
Pisum sativum
Plant Mol. Biol.
The plant homologue of MAP kin ...
Medicago sativa
Plant J.
MsERK1: a mitogen-activated pr ...
Medicago sativa
Plant Cell
ATMPKs: a gene family of plant ...
Arabidopsis thaliana
FEBS Lett.
Isolation and characterization ...
Nicotiana tabacum
Plant Mol. Biol.
Primary structure, expression, ...
Drosophila melanogaster
Proc. Natl. Acad. Sci. USA
Signal transduction in Sacchar ...
Saccharomyces cerevisiae
Genes Dev.
Van Dyck
An 11.4 kb DNA segment on the ...
Saccharomyces cerevisiae
The DAC2/FUS3 protein kinase i ...
Saccharomyces cerevisiae
Mol. Gen. Genet.
Sequence of a rat cDNA encodin ...
Rattus norvegicus
Requirements for phosphorylati ...
Xenopus laevis
Extracellular signal-regulated ...
Homo sapiens
Biochem. Biophys. Res. Commun.
Heterogeneous expression of fo ...
Homo sapiens, Schizosaccharomyces pombe
FEBS Lett.
Dominant negative selection of ...
Candida albicans
Proc. Natl. Acad. Sci. USA
Purification and properties of ...
Rattus norvegicus
Pseudosubstrate-based peptide ...
Methods Enzymol.
Microtubule-associated protein ...
Rattus norvegicus
Proc. Natl. Acad. Sci. USA
De Miguel
Molecular analysis of microtub ...
Rattus norvegicus
DNA Cell Biol.
Tyrosine phosphorylation and a ...
Xenopus laevis
Mol. Cell. Biol.
Xenopus M phase MAP kinase: is ...
Xenopus laevis
Fission yeast genes that confe ...
Schizosaccharomyces pombe
Genes Dev.
Identification of the regulato ...
Mus musculus
Sequence of pp42/MAP kinase, a ...
Mus musculus
Nucleic Acids Res.
ERKs: a family of protein-seri ...
Mus musculus, Rattus norvegicus
A protein kinase gene compleme ...
Saccharomyces cerevisiae
Mol. Microbiol.
FUS3 encodes a cdc2+/CDC28-rel ...
Saccharomyces cerevisiae
An insulin-stimulated protein ...
Rattus norvegicus
A putative protein kinase over ...
Saccharomyces cerevisiae