Information on EC 3.4.23.5 - cathepsin D

Word Map on EC 3.4.23.5
Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Specify your search results
Select one or more organisms in this record:
Show additional data
Do not include text mining results
Include (text mining) results (more...)
Include results (AMENDA + additional results, but less precise; more...)

The enzyme appears in viruses and cellular organisms

EC NUMBER
COMMENTARY hide
3.4.23.5
-
RECOMMENDED NAME
GeneOntology No.
cathepsin D
REACTION
REACTION DIAGRAM
COMMENTARY hide
ORGANISM
UNIPROT
LITERATURE
Specificity similar to, but narrower than, that of pepsin A. Does not cleave the Gln4-His bond in B chain of insulin
show the reaction diagram
-
-
-
-
REACTION TYPE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
hydrolysis of peptide bond
-
-
endopeptidase; peptides, endopeptidase
-
CAS REGISTRY NUMBER
COMMENTARY hide
9025-26-7
-
ORGANISM
COMMENTARY hide
LITERATURE
UNIPROT
SEQUENCE DB
SOURCE
-
-
-
Manually annotated by BRENDA team
-
UniProt
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
-
UniProt
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
Japanese lamprey
UniProt
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
; turbot, formerly named Scophthalmus maximus
UniProt
Manually annotated by BRENDA team
cuttlefish
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
Japanese common squid
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
GENERAL INFORMATION
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
malfunction
metabolism
physiological function
SUBSTRATE
PRODUCT                       
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
Reversibility
r=reversible
ir=irreversible
?=not specified
((7-methoxycoumarin-4-yl)acetyl-Pro-Leu-Gly-Leu-N-3-(2,4-dinitro-phenyl)-L-2,3-diaminopropionyl-Ala-Arg-NH2) + H2O
?
show the reaction diagram
-
-
-
-
?
(7-methoxycoumarin-4-yl)acetyl-GKPILFFRLK(Dnp)-RNH2 + H2O
(7-methoxycoumarin-4-yl)acetyl-GKPILF + FRLK(Dnp)-RNH2
show the reaction diagram
-
-
-
-
?
(7-methoxycoumarin-4-yl)acetyl-Gly-Lys-Pro-Ile-Ile-Phe-Phe-Arg-Leu-Lys(Dnp)-D-Arg-NH2 + H2O
?
show the reaction diagram
-
-
-
-
?
(7-methoxycoumarin-4-yl)acetyl-Gly-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Lys(Dnp)-D-Arg-amide + H2O
(7-methoxycoumarin-4-yl)acetyl-Gly-Lys-Pro-Ile-Leu-Phe + Phe-Arg-Leu-Lys(Dnp)-D-Arg-amide
show the reaction diagram
-
-
-
-
?
(7-methoxycoumarin-4-yl)acetyl-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 + H2O
?
show the reaction diagram
-
-
-
-
?
(7-methoxycoumarin-4-yl)acetyl-Gly-Ser-Ser-Ala-Phe-Leu-Ala-Phe-Lys(Dnp)-D-Arg-NH2 + H2O
?
show the reaction diagram
-
-
-
-
?
(7-methoxycoumarin-4-yl)acetyl-Pro-Leu-Gly-Leu-N-3-(2,4-dinitrophenyl)-L-2,3-diaminopropionyl-Ala-Arg-NH2 + H2O
?
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-AAKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AAKF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AEKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AEKF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIAFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIAF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIEFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIEF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIFFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIFF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIIFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIIF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFARQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FARQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFERQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FERQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFIRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FIRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFKRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FKRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFLRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FLRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFNRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FNRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFORQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FORQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFRRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FRRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFSAQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FSAQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
2-aminobenzoyl-AIKFFSAQTNRHILRFNRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FSAQTNRHILRFNRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
2-aminobenzoyl-AIKFFSAQTNRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FSAQTNRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
2-aminobenzoyl-AIKFFSEQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FSEQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFSIQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FSIQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFSKQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FSKQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFSLQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FSLQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFSNQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FSNQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFSOQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FSOQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFSPQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FSPQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFSSQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FSSQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFSTQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FSTQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFSVQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FSVQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFTRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FTRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFFVRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + FVRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKFMSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKF + MSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKLFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKL + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKLLSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKL + LSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKLMSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKL + MSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKMFLRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKM + LSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKMFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKM + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKMMSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKM + MSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIKYYSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIKY + YSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AILFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AILF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIMFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIMF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AINFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AINF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIPFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIPF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIQFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIQF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AISFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AISF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AITFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AITF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AIVFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AIVF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AKKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AKKF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-ALKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-ALKF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-ANKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-ANKF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
2-aminobenzoyl-APKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-APKF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AQKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AQKF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-ASKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-ASKF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-ATKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-ATKF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
2-aminobenzoyl-AVKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-AVKF + FSRQ-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
-
-
?
7-methoxycoumarin-4-acetyl-Gly-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Lys(DNP)-Arg-amide + H2O
?
show the reaction diagram
-
-
-
-
?
7-methoxycoumarin-4-yl-GKPILFFRLK(2,4-dinitrophenyl)-D-Arg + H2O
?
show the reaction diagram
-
-
-
?
7-methoxycoumarin-4-yl-SEVNLDAEFRK(2,4-dinitrophenyl)RR + H2O
?
show the reaction diagram
-
-
-
?
acid-denatured casein + H2O
?
show the reaction diagram
-
-
-
?
Acid-denatured hemoglobin + H2O
?
show the reaction diagram
actin + H2O
?
show the reaction diagram
actomyosin + H2O
?
show the reaction diagram
-
-
-
-
?
Ala-Pro-Ala-Lys-Phe-(4-nitro)Phe-Arg-Leu + H2O
Ala-Pro-Ala-Lys-Phe + (4-nitro)Phe-Arg-Leu
show the reaction diagram
-
-
-
?
Albumin + H2O
?
show the reaction diagram
aldehyde-modified bovine serum albumin + H2O
?
show the reaction diagram
-
-
-
-
?
alpha-globulin + H2O
?
show the reaction diagram
-
12% cleavage at pH 3.0 and 3.5
-
-
?
alpha-synuclein + H2O
?
show the reaction diagram
alpha1-Antichymotrypsin + H2O
?
show the reaction diagram
Amca-EEKPISFFRLGK + H2O
Amca-EEKPISF + FRLGK
show the reaction diagram
-
CatD cleaves the substrate Amca-EEKPISFFRLGK specifically between the two phenylalanine residues yielding the two peptides Amca-EEKPISF and FRLGK. Only the first peptide can be detected using fluorescence detection
-
-
?
AMCA-Glu-Glu-L-Lys-L-Pro-L-Ile-L-Ser-L-Phe-L-Phe-L-Arg-L-Leu-Gly-L-Lys(biotinyl)-NH2 + H2O
AMCA-Glu-Glu-L-Lys-L-Pro-L-Ile-L-Ser-L-Phe + L-Phe-L-Arg-L-Leu-Gly-L-Lys(biotinyl)-NH2
show the reaction diagram
-
-
-
-
?
aminomethylcoumarin-hemoglobin + H2O
?
show the reaction diagram
-
-
-
-
?
aminomethylcoumarine-conjugated hemoglobin + H2O
?
show the reaction diagram
-
-
-
-
?
amyloid beta A4 protein + H2O
?
show the reaction diagram
-
-
-
-
?
amyloid beta-protein + H2O
?
show the reaction diagram
-
-
-
?
amyloid precursor protein + H2O
?
show the reaction diagram
-
-
-
-
?
androgen receptor + H2O
?
show the reaction diagram
-
-
-
-
?
angiostatin + H2O
?
show the reaction diagram
-
-
-
-
?
apolipoprotein B + H2O
?
show the reaction diagram
apolipoprotein E + H2O
?
show the reaction diagram
-
-
-
-
?
Arg-Pro-Ala-Lys-Phe-(4-nitro)Phe-Arg-Leu + H2O
Arg-Pro-Ala-Lys-Phe + (4-nitro)Phe-Arg-Leu
show the reaction diagram
-
-
-
?
Asp-Pro-Ala-Lys-Phe-(4-nitro)Phe-Arg-Leu + H2O
Asp-Pro-Ala-Lys-Phe + (4-nitro)Phe-Arg-Leu
show the reaction diagram
-
-
-
?
benzoyl-L-Arg-Gly-L-Phe-L-Phe-L-Leu-4-methoxy-2-naphthylamide + H2O
?
show the reaction diagram
-
-
-
-
?
benzoyl-L-Arg-L-Pro-L-Phe-L-Phe-L-Leu-4-methoxy-2-naphthylamide + H2O
?
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-L-Pro-L-Phe-L-His-L-Leu-L-Leu-L-Val-L-Tyr-L-Ser-2-naphthylamide + H2O
?
show the reaction diagram
-
-
-
-
?
beta-globulin + H2O
?
show the reaction diagram
-
10% cleavage at pH 3.0 and 3.5
-
-
?
BID + H2O
?
show the reaction diagram
-
-
-
-
?
bovine aggrecan + H2O
?
show the reaction diagram
-
cleavage at five sites within the core protein, no preferential cleqavage at any one site
-
?
Bovine hemoglobin + H2O
?
show the reaction diagram
-
conjugated to the fluorochrome 6-((7-amino-4-methylcoumarin-3-acetyl) amino) hexanoic acid, succinimidyl ester
-
-
?
Bovine serum albumin + H2O
?
show the reaction diagram
casein + H2O
?
show the reaction diagram
caspase-3 + ?
?
show the reaction diagram
-
-
-
-
?
cathepsin B + H2O
?
show the reaction diagram
-
-
-
-
?
cathepsin L + H2O
?
show the reaction diagram
-
-
-
-
?
collagens + H2O
?
show the reaction diagram
-
-
-
-
?
connectin + H2O
?
show the reaction diagram
-
-
-
-
?
cystatin C + H2O
?
show the reaction diagram
-
-
-
-
?
D-Phe-L-Ser-L-Phe-L-Phe-L-Ala-L-Ala-4-aminobenzoate + H2O
D-Phe-L-Ser-L-Phe + L-Phe-L-Ala-L-Ala-4-aminobenzoate
show the reaction diagram
-
-
-
-
?
D-Phe-L-Ser-L-Ser-L-Phe-L-Phe-L-Ala-4-aminobenzoate + H2O
?
show the reaction diagram
-
-
-
-
?
dermcidin + H2O
?
show the reaction diagram
-
-
-
-
?
EEISEVKMDAEFRG + H2O
EEISEVKM + DAEFRG
show the reaction diagram
EEISEVNLDAEFRG + H2O
EEISEVNL + DAEFRG
show the reaction diagram
endostatin + H2O
?
show the reaction diagram
-
-
-
-
?
Fibrin + H2O
?
show the reaction diagram
Fibrinogen + H2O
?
show the reaction diagram
fibrinogen + H2O
low molecular weight fragments of fibrinogen
show the reaction diagram
-
cleaves the alpha-chain, the beta-chain and the gamma-chain
-
?
fibroblast growth factor + H2O
?
show the reaction diagram
-
-
-
-
?
Fibronectin + H2O
?
show the reaction diagram
-
-
-
-
?
gamma-globulin + H2O
?
show the reaction diagram
-
2.6% activity compared to hemoglobin
-
-
?
Gelatin + H2O
?
show the reaction diagram
-
12.9% activity compared to hemoglobin
-
-
?
GKPILFFRLK(Dnp)-D-R-NH2 + H2O
?
show the reaction diagram
-
-
-
-
?
Glu-Glu-His-Phe-Phe-Ala-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
Glu-Glu-His-Phe-Phe-Ala-Leu-methyl ester + H2O
?
show the reaction diagram
-
-
-
-
?
Glu-His-(4-nitro)Phe-Phe-Ala-Leu-NH2 + H2O
?
show the reaction diagram
-
-
-
-
?
Glucagon + H2O
?
show the reaction diagram
-
-
-
-
?
Gly-L-Phe-L-Leu-Gly-D-Phe-L-Leu + H2O
Gly-L-Phe-L-Leu-Gly + D-Phe-L-Leu
show the reaction diagram
-
3.0% cleavage
-
-
?
Gly-L-Phe-L-Leu-Gly-L-Phe-D-Leu + H2O
Gly-L-Phe-L-Leu-Gly + L-Phe-D-Leu
show the reaction diagram
-
6.0% cleavage
-
-
?
Gly-L-Phe-L-Leu-Gly-L-Phe-L-Leu + H2O
Gly-L-Phe-L-Leu-Gly + L-Phe-L-Leu
show the reaction diagram
-
100% cleavage
-
-
?
glycated hemoglobin + H2O
LVV-hemorphin-7 + VV-hemorphin-7 + hemorphin-7 + ?
show the reaction diagram
-
-
-
-
?
glyoxal-modified albumin + H2O
?
show the reaction diagram
-
-
-
-
?
Hemoglobin + H2O
?
show the reaction diagram
histone H2A + H2O
?
show the reaction diagram
-
-
-
-
?
histone H2A + H2O
parasin I + ?
show the reaction diagram
-
cleavage of Ser19-Arg20 bond
-
?
human apo-transferrin + H2O
?
show the reaction diagram
-
-
-
-
?
human serum albumin + H2O
?
show the reaction diagram
-
-
-
-
?
insulin + H2O
?
show the reaction diagram
insulin beta-chain
?
show the reaction diagram
-
preferential cleavage in decreasing order: L15-Y16, Y16-L17, A14-L15
-
?
insulin-like growth factor binding protein + H2O
?
show the reaction diagram
-
-
-
-
?
interleukin-1 + H2O
?
show the reaction diagram
-
-
-
-
?
kallistatin + H2O
?
show the reaction diagram
kininogen + H2O
?
show the reaction diagram
-
-
-
-
?
L-Asp-L-Arg-L-Val-L-Tyr-L-Ile-L-His-L-Pro-L-Phe-L-His-L-Leu-L-Leu-L-Val-L-Tyr-L-Ser-OH + H2O
?
show the reaction diagram
-
-
-
-
?
L-Asp-L-Arg-L-Val-L-Tyr-L-Ile-L-His-L-Pro-L-Phe-L-His-L-Leu-L-Val-L-Ile-L-His-OH + H2O
?
show the reaction diagram
-
-
-
-
?
L-Asp-L-Val-L-Arg-L-Tyr-L-Ile-L-His-L-Pro-L-Phe-L-His-L-Leu-L-Leu-L-Val-L-Tyr-L-Ser-OH + H2O
?
show the reaction diagram
-
-
-
-
?
L-Phe-L-Ala-L-Ala-L-Phe(NO2)-L-Phe-L-Val-L-Leu-4-hydroxymethyl(pyridine) + H2O
L-Phe-L-Ala-L-Ala-L-Phe(NO2) + L-Phe-L-Val-L-Leu-4-hydroxymethyl(pyridine)
show the reaction diagram
-
-
-
-
?
Leu-Pro-Ala-Lys-Phe-(4-nitro)Phe-Arg-Leu + H2O
Leu-Pro-Ala-Lys-Phe + (4-nitro)Phe-Arg-Leu
show the reaction diagram
-
-
-
?
[LL-37, 37 aa] + H2O
LLGDF + FRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
show the reaction diagram
-
LL-37, peptide present in human sweat. Only weak cleavage is seen between Phe5 and Phe6 yielding FRK-32 and between Phe27 and Leu28 yielding LRN-10 and LLG-27
-
-
?
[LL-37, 37 aa] + H2O
LLGDFFRKSKEKIGKEFKRIVQRIKDF + LRNLVPRTES
show the reaction diagram
-
LL-37, peptide present in human sweat. Only weak cleavage is seen between Phe5 and Phe6 yielding FRK-32 and between Phe27 and Leu28 yielding LRN-10 and LLG-27
-
-
?
LLVVFF + H2O
LVVFF + VVFF + LLVVF + LVVF + VVF + Leu-Leu + Phe
show the reaction diagram
-
-
-
-
?
LLVVYPWTQRFF + H2O
LVVYPWTQRFF + VVYPWTQRFF + LLVVYPWTQRF + LVVYPWTQRF + VVYPWTQRF + Leu-Leu + Phe
show the reaction diagram
-
cleavage occurs at the C-terminus (F-F) and the N-terminus (L-L, L-V and LL-V)
-
-
?
Lys-Pro-Ala-Asp-Phe-(4-nitro)Phe-Arg-Leu + H2O
Lys-Pro-Ala-Asp-Phe + (4-nitro)Phe-Arg-Leu
show the reaction diagram
-
-
-
?
Lys-Pro-Asn-Gln-Phe-(4-nitro)Phe-Arg-Leu + H2O
Lys-Pro-Asn-Gln-Phe + (4-nitro)Phe-Arg-Leu
show the reaction diagram
-
-
-
?
Lys-Pro-Ile-Glu-Phe-(4-nitro)Phe-Arg-Leu + H2O
Lys-Pro-Ile-Glu-Phe + (4-nitro)Phe-Arg-Leu
show the reaction diagram
Lys-Pro-Thr-Val-Phe-(4-nitro)Phe-Arg-Leu + H2O
Lys-Pro-Thr-Val-Phe + (4-nitro)Phe-Arg-Leu
show the reaction diagram
-
-
-
?
Lys-Pro-Val-Ser-Tyr-(4-nitro)Phe-Arg-Leu + H2O
Lys-Pro-Val-Ser-Tyr + (4-nitro)Phe-Arg-Leu
show the reaction diagram
-
-
-
?
lysozyme tryptide + H2O
?
show the reaction diagram
-
cleavage sites
-
-
?
macrophage inflammatory protein-1 alpha + H2O
?
show the reaction diagram
-
-
-
-
?
macrophage inflammatory protein-1 beta + H2O
?
show the reaction diagram
-
-
-
-
?
mannose 6-phosphate receptor 300 + H2O
?
show the reaction diagram
-
receptor of cathepsin D
-
-
?
Mca-Pro-Leu-Gly-Leu-Dpa-Ala-Arg-NH2 + H2O
?
show the reaction diagram
-
-
-
-
?
methylglyoxal-modified albumin + H2O
?
show the reaction diagram
-
-
-
-
?
MOCAc-GKPIFFRLK-(DNP)-DR-NH2 + H2O
?
show the reaction diagram
-
-
-
?
MOCAc-Gly-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Lys(Dnp)-D-Arg-NH2 + H2O
?
show the reaction diagram
-
-
-
-
?
MOCAc-Gly-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Lys(Dnp)gamma-NH2 + H2O
?
show the reaction diagram
-
-
-
-
?
mutant huntingtin + H2O
?
show the reaction diagram
-
-
-
-
?
myelin basic protein + H2O
?
show the reaction diagram
-
-
-
-
?
myofibrillar protein + H2O
?
show the reaction diagram
-
-
-
-
?
myofibrils + H2O
?
show the reaction diagram
-
-
-
-
?
Myoglobin + H2O
?
show the reaction diagram
myosin + H2O
?
show the reaction diagram
myosin heavy chain + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Gly-L-Phe-L-Leu-Gly-L-Phe-OH + H2O
?
show the reaction diagram
-
-
-
-
?
N-t-BOC-Phe-Ala-Ala-Phe(4-nitro)-Phe-Val-Leu-4-hydroxymethylpyridine ester + H2O
?
show the reaction diagram
-
-
-
-
?
neurofilaments + H2O
?
show the reaction diagram
-
-
-
-
?
neuropeptide K + H2O
?
show the reaction diagram
-
cleaved at a Lys-Arg basic residue site
-
-
?
osteocalcin + H2O
?
show the reaction diagram
-
-
-
-
?
osteopontin + H2O
?
show the reaction diagram
-
cathepsin D hydrolyzes the Leu38-Leu39 and Leu151-Arg152 bonds resulting in an osteopontin fragment consisting of residues Leu39-Leu151
-
-
?
oxidized insulin B chain
?
show the reaction diagram
-
analysis of cleavage specificity at different pH-values
-
?
oxidized insulin beta-chain + H2O
?
show the reaction diagram
-
-
-
?
paramyosin + H2O
?
show the reaction diagram
-
-
-
-
?
Parathyroid hormone + H2O
?
show the reaction diagram
-
-
-
-
?
parathyroid hormone + H2O
peptide fragments of parathyroid hormone
show the reaction diagram
-
-
the enzyme generates to major COOH-terminal products, 35-84 and 38-84. The complemetary NH2-ternminal fragments 1-34 and 1-37 are both fully biologically active
?
peptide D + H2O
?
show the reaction diagram
-
-
-
-
?
Phe-Ala-Ala-(4-nitro)Phe-Phe-Val-Leu-4-hydroxymethylpyridine ester + H2O
?
show the reaction diagram
-
-
-
-
?
Phe-Gly-Gly-(4-nitro)Phe-Phe-Val-Leu-methyl ester + H2O
?
show the reaction diagram
-
-
-
-
?
plasminogen + H2O
?
show the reaction diagram
-
-
-
-
?
porcine hemoglobin + H2O
?
show the reaction diagram
-
-
-
-
?
porcine serum albumin + H2O
?
show the reaction diagram
-
-
-
-
?
pro-caspase-8 + H2O
caspase-8 + ?
show the reaction diagram
-
the generation of an active caspase-8 requires both cathepsin D-mediated proteolysis and homodimerization of caspase-8
-
-
?
Pro-Pro-Thr-Ile-Phe-(4-nitro)Phe-Arg-Leu + H2O
?
show the reaction diagram
-
-
-
-
?
proacrosin + H2O
acrosin + ?
show the reaction diagram
-
-
-
?
prolactin + H2O
?
show the reaction diagram
prolactin + H2O
vasoinhibin + ?
show the reaction diagram
-
cleavage at Ser149
-
-
?
prosaposin + H2O
?
show the reaction diagram
-
-
-
-
?
protein-polysaccharide complex of bovine nasal cartilage + H2O
fragments of bovine nasal cartilage
show the reaction diagram
-
-
fragments are larger than single chains of chondroitin sulfate
?
proteinaceous cysteine protease inhibitor from soybean sCN + H2O
?
show the reaction diagram
-
-
-
?
proteoglycans + H2O
?
show the reaction diagram
-
-
-
-
?
renin substrate tetradecapeptide + H2O
?
show the reaction diagram
-
-
-
?
R[K-2,4-dinitrophenyl]LRFFLIPK[G-7-amido-4-methylcoumarin] + H2O
R[K-2,4-dinitrophenyl]LRF + FLIPK[G-7-amido-4-methylcoumarin]
show the reaction diagram
-
-
-
-
?
secondary lymphoid-tissue chemokine + H2O
?
show the reaction diagram
-
-
-
-
?
Ser-Pro-Ala-Lys-Phe-(4-nitro)Phe-Arg-Leu + H2O
Ser-Pro-Ala-Lys-Phe + (4-nitro)Phe-Arg-Leu
show the reaction diagram
-
-
-
?
serum albumin + H2O
?
show the reaction diagram
-
-
-
?
serum amyloid A protein + H2O
?
show the reaction diagram
-
-
-
-
?
SEVKMDAEFR + H2O
SEVKM + DAEFR
show the reaction diagram
SEVNLDAEFR + H2O
SEVNL + DAEFR
show the reaction diagram
SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL + H2O
SSLLEKGLDGAKKAVGGLGKLGKDAVEDL + ESVGKGAVHDVKDVLDSVL
show the reaction diagram
-
DCD-1L, peptide present in human sweat. DCD-1L is cleaved by CatD dominantly between Leu44 and Asp45 yielding SSL-44 and the tetrapeptide DSVL and to a lower amount between Leu29 and Glu30 leading to the peptide SSL-29 and corresponding peptides ESV-19 and ESV-15, respectively. These cleavage sites agree well with the specificity of CatD, which preferably cleaves proteins and peptides with leucine or an aromatic amino acid residue in the P1 position
-
-
?
SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL + H2O
SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVL + DSVL
show the reaction diagram
-
DCD-1L, peptide present in human sweat. DCD-1L is cleaved by CatD dominantly between Leu44 and Asp45 yielding SSL-44 and the tetrapeptide DSVL and to a lower amount between Leu29 and Glu30 leading to the peptide SSL-29 and corresponding peptides ESV-19 and ESV-15, respectively. These cleavage sites agree well with the specificity of CatD, which preferably cleaves proteins and peptides with leucine or an aromatic amino acid residue in the P1 position
-
-
?
T-kininogen + H2O
T-kinin-Leu + H2O
show the reaction diagram
-
-
-
?
Tau + H2O
?
show the reaction diagram
-
-
-
-
?
tau protein + H2O
?
show the reaction diagram
-
-
-
-
?
thioredoxin-1 + H2O
?
show the reaction diagram
-
-
-
-
?
thyroglobulin + H2O
?
show the reaction diagram
-
-
-
-
?
transglutaminase 1 + H2O
?
show the reaction diagram
-
-
-
-
?
tropomyosin + H2O
?
show the reaction diagram
tubulin + H2O
?
show the reaction diagram
-
-
-
-
?
vitellogenin + H2O
lipovitellin 1 + lipovitelin 2
show the reaction diagram
[aminooxy-acetyl-K]LLVVFF[D-PEG2] + H2O
[aminooxy-acetyl-K]LL + VVF + VVFF[D-PEG2] + F[D-PEG2]
show the reaction diagram
-
the proform of cathepsin D cleaves the substrate at pH 6.5 with the same cleavage selectivity obtained with the mature form of the protease
-
-
?
additional information
?
-
NATURAL SUBSTRATES
NATURAL PRODUCTS
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
REVERSIBILITY
r=reversible
ir=irreversible
?=not specified
Albumin + H2O
?
show the reaction diagram
-
15% cleavage at pH 3.0
-
-
?
alpha-globulin + H2O
?
show the reaction diagram
-
12% cleavage at pH 3.0 and 3.5
-
-
?
alpha-synuclein + H2O
?
show the reaction diagram
P07339
-
-
-
?
amyloid precursor protein + H2O
?
show the reaction diagram
-
-
-
-
?
angiostatin + H2O
?
show the reaction diagram
-
-
-
-
?
apolipoprotein E + H2O
?
show the reaction diagram
-
-
-
-
?
beta-globulin + H2O
?
show the reaction diagram
-
10% cleavage at pH 3.0 and 3.5
-
-
?
casein + H2O
?
show the reaction diagram
-
20% cleavage at pH 3.5
-
-
?
endostatin + H2O
?
show the reaction diagram
-
-
-
-
?
Fibrin + H2O
?
show the reaction diagram
-
12% cleavage at pH 3.0
-
-
?
Hemoglobin + H2O
?
show the reaction diagram
histone H2A + H2O
parasin I + ?
show the reaction diagram
-
cleavage of Ser19-Arg20 bond
-
?
mannose 6-phosphate receptor 300 + H2O
?
show the reaction diagram
-
receptor of cathepsin D
-
-
?
pro-caspase-8 + H2O
caspase-8 + ?
show the reaction diagram
-
the generation of an active caspase-8 requires both cathepsin D-mediated proteolysis and homodimerization of caspase-8
-
-
?
prolactin + H2O
?
show the reaction diagram
-
-
-
-
?
tau protein + H2O
?
show the reaction diagram
-
-
-
-
?
additional information
?
-
METALS and IONS
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
Ca2+
-
activates
Co2+
-
239.4% activity at 5 mM
Cu2+
-
157% activity at 5 mM
Fe2+
-
activates
Sr2+
-
212.5% activity at 5 mM
additional information
-
cathepsin D is not affected by Na+, K+, and Ca2+
INHIBITORS
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
(3S,4S)-5-(4-bromobenzyloxy)-3-hydroxy-4-(2-thiophen-2-ylacetylamino)pentanoic acid [(S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)ethyl]amide
-
-
(3S,4S)-5-(4-bromobenzyloxy)-4-(3,3-diphenylpropionylamino)-3-hydroxypentanoic acid [(S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)ethyl]amide
-
-
(3S,4S)-5-(4-bromobenzyloxy)-4-diphenylacetylamino-3-hydroxypentanoic acid [(S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)ethyl]amide
-
-
(5Z)-5-[4-[(4-benzoyl-3-hydroxy-2-propylphenoxy)methyl]benzylidene]-2-thioxo-1,3-thiazolidin-4-one
-
-
(NH4)2SO4
-
-
(S)-2,3-dihydro-1H-indole-2-carboxylic acid ((1S,2S)-1-(4-bromobenzyloxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)ethylcarbamoyl]-2-hydroxypropyl)amide
-
-
1,2-epoxy-3-(4-nitrophenoxy)propane
1,2-epoxy-3-(p-nitrophenoxy)-propane
-
4.5 mM, 68% residual activity
2-(3,4-dimethoxyphenyl)-N-[N-(4-methylbenzyl)carbamimidoyl]acetamide
-
-
2-aminobenzoyl-AFKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
-
2-aminobenzoyl-AIHFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
-
2-aminobenzoyl-AIKFFHRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
-
2-aminobenzoyl-AIKFFPRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
-
2-aminobenzoyl-AIKFFSFQ-N-(2,4-dinitrophenyl)ethylenediamine
-
-
2-aminobenzoyl-AIKIISRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
-
2-aminobenzoyl-AIKQQSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
-
2-aminobenzoyl-AIKVVSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
-
2-bromo-N-[(2S,3S)-4-[[2-(2,4-dichlorophenyl)ethyl][3-(1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)propanoyl]amino]-3-hydroxy-1-(3-phenoxyphenyl)butan-2-yl]-4,5-dimethoxybenzamide
-
-
2-mercaptoethanol
-
-
3,5-dichloro-2-[[(3,5-dichloro-2-hydroxyphenyl)sulfonyl]amino]-N-[4-[(6-ethoxy-1,3-benzothiazol-2-yl)sulfanyl]phenyl]benzamide
-
-
3-cyclohexyl-N-(3,4-difluorobenzyl)-N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-D-alaninamide
-
-
3-cyclohexyl-N-(3,4-dimethoxybenzyl)-N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-D-alaninamide
-
-
3-cyclohexyl-N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-(3-fluoro-4-methoxybenzyl)-D-alaninamide
-
-
3-cyclohexyl-N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-(4-fluoro-3-methoxybenzyl)-D-alaninamide
-
-
3-cyclohexyl-N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[3-(1H-tetrazol-5-yl)benzyl]-D-alaninamide
-
-
3-cyclohexyl-N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[3-fluoro-4-(1H-tetrazol-5-yl)benzyl]-D-alaninamide
-
-
3-cyclohexyl-N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[4-(1H-tetrazol-5-yl)benzyl]-D-alaninamide
-
-
3-indolepyruvate
-
-
3-p-hydroxyphenylpyruvate
-
-
3-phenylpyruvate
-
-
4-bromophenacyl bromide
-
-
4-bromophenylacylbromide
-
-
6-aminohexanoate
Ascaris inhibitor
-
-
-
ascorbic acid
-
-
Ba2+
-
54% residual activity at 5 mM
cathepsin D inhibitor from Streptomyces sp.MBR04
-
reversible, competitive, slow-tight-binding inhibitor
-
CEL5-A
-
disruption of single- to heavy-chain formation
CEL5-G
-
disruption of single- to heavy-chain formation
Chloroquine
-
-
Diazoacetyl-DL-norleucine methyl ester
Diazoacetylglycine ethyl ester
-
-
dithioerythritol
-
-
dithiothreitol
DNA18b
-
i.e. 5’-ggctcaggtacccagaga-3’, at 100 nM, 40% inhibition
-
DNA53b
-
i.e. 5’-gctctagatcaatgatgatgatgatgatgctggcgtttccgaggggggcgctt-3’, 80% inhibition at 100 nM, complete inhibition at 0.001 mM
-
E-64
-
83% residual activity at 1 mM
EA-1
-
disruption of single- to heavy-chain formation
equistatin
-
-
-
ethanol
H-256
-
i.e. L-Glu-L-Pro-L-Thr-L-alpha-Glu-L-Phe-PSI[CH2-NH]-L-Phe-L-Arg
H-261
-
i.e. L-His-L-His-L-Pro-L-Phe-L-His-(2S,4S,5S)-5-amino-4-hydroxy-7-methyl-2-(1-methylethyl)octanoyl-L-Ile
inhibitor isolated from potato
-
-
-
inhibitor isolated from potatoes
-
inhibitor isolated from tomato
-
recombinant protein, GenBank accession no. AJ289776
-
iodoacetic acid
-
76% residual activity at 1 mM
isovaleryl-pepstatin
-
-
-
Kallikrein
-
-
-
KCl
-
-
L-363,564
-
-
L-Cys
Lactoyl-pepstatin
-
-
-
molybdate
-
2.3% residual activity at 1 mM
Monoiodoacetic acid
N-((1S,2S)-1-(4-benzo[1,3]dioxol-5-yl-benzyloxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)-ethylcarbamoyl]-2-hydroxy-propyl)-2,4,6-trifluorobenzamide
-
-
N-((1S,2S)-1-(4-bromobenzyloxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)ethylcarbamoyl]-2-hydroxypropyl)-3,4-dichlorobenzamide
-
-
N-((1S,2S)-1-(biphenyl-4-ylmethoxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)-ethylcarbamoyl]-2-hydroxy-propyl)-2,4,6-trifluorobenzamide
-
-
N-(3,4-dimethoxybenzyl)-N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-D-leucinamide
-
-
N-(3,4-dimethoxybenzyl)-Na-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-D-phenylalaninamide
-
-
N-(N-benzylcarbamimidoyl)-2-(2-chloro-5-methoxyphenyl)acetamide
-
-
N-(N-benzylcarbamimidoyl)-2-(4,5-dimethoxy-2-nitrophenyl)acetamide
-
-
N-(N-benzylcarbamimidoyl)-3-(3,4-dimethoxyphenyl)propanamide
-
-
N-(N-benzylcarbamimidoyl)-4-(4,5-dimethoxy-2-nitrophenyl)butanamide
-
-
N-bromosuccinimide
-
0.05 mM, 50% inhibition
N-[(1S,2S)-1-(biphenyl-4-ylmethoxymethyl)-3-cyclo-hexylcarbamoyl-2-hydroxypropyl]-2,4,6-trifluorobenzamide
-
-
N-[(1S,2S)-3-cyclohexylcarbamoyl-2-hydroxy-1-(4-thiophen-3-yl-benzyloxymethyl)-propyl]-2,4,6-trifluorobenzamide
-
-
N-[(1S,2S)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butyl-carbamoyl)-ethylcarbamoyl]-2-hydroxy-1-(4-thiophen-3-yl-benzyloxymethyl)-propyl]-2,4,6-trifluorobenzamide
-
-
N-[N-(2-chlorobenzyl)carbamimidoyl]-2-(4,5-dimethoxy-2-nitrophenyl)acetamide
-
-
N-[N-(3,4-dichlorobenzyl)carbamimidoyl]-2-(4,5-dimethoxy-2-nitrophenyl)acetamide
-
-
N-[N-(3,4-dimethoxybenzyl)carbamimidoyl]-2-(4,5-dimethoxy-2-nitrophenyl)acetamide
-
-
N-[N-(4-aminobenzyl)carbamimidoyl]-2-(3,4-dimethoxyphenyl)acetamide
-
-
N-[N-(4-chlorobenzyl)carbamimidoyl]-2-(4,5-dimethoxy-2-nitrophenyl)acetamide
-
-
N2-[N-[(2-bromo-4,5-dimethoxyphenyl)acetyl]carbamimidoyl]-3-cyclohexyl-N-(4-fluoro-3-methoxybenzyl)-D-alaninamide
-
-
N2-[N-[(2-bromo-4,5-dimethoxyphenyl)acetyl]carbamimidoyl]-3-cyclohexyl-N-[3-(1H-tetrazol-5-yl)benzyl]-D-alaninamide
-
-
N2-[N-[(2-bromo-4,5-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[3-(1H-tetrazol-5-yl)benzyl]-D-leucinamide
-
-
N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-(4-fluoro-3-methoxybenzyl)-D-leucinamide
-
-
N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[2-fluoro-3-(1H-tetrazol-5-yl)benzyl]-D-leucinamide
-
-
N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[3-(1H-tetrazol-5-yl)benzyl]-D-leucinamide
-
-
N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[3-fluoro-4-(1H-tetrazol-5-yl)benzyl]-D-leucinamide
-
-
N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[4-(1H-tetrazol-5-yl)benzyl]-D-leucinamide
-
-
Na-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[2-(1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)ethyl]-D-phenylalaninamide
-
-
Na-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[2-(1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)ethyl]-L-phenylalaninamide
-
-
NaCl
-
10%, almost complete inactivation
Pepstatin
pepstatin A
phenylmethanesulfonyl fluoride
-
slight
phenylpyruvate
-
-
plasmid DNA
-
length 50 kbp, double strand, 50% inhibition at 60 pM
-
potassium permanganate
-
0.01 mM, 50% inhibition
pyridine-2-carboxylic acid ((R)-1-((1S,2S)-1-(4-bromobenzyloxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)ethylcarbamoyl]-2-hydroxypropylcarbamoyl)-2-methylpropyl)amide
-
-
pyridine-2-carboxylic acid ((S)-1-((1S,2S)-1-(3-bromobenzyloxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)-ethylcarbamoyl]-2-hydroxypropylcarbamoyl)-2-methyl-propyl)-amide
-
-
pyridine-2-carboxylic acid ((S)-1-((1S,2S)-1-(4-benzo-[1,3]dioxol-5-yl-benzyloxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)-ethylcarbamoyl]-2-hydroxypropylcarbamoyl)-2-methylpropyl)-amide
-
-
pyridine-2-carboxylic acid ((S)-1-((1S,2S)-1-(4-bromobenzyloxymethyl)-2-hydroxy-3-(2-(3-methoxyphenyl)ethylcarbamoyl)propylcarbamoyl)-2-methylpropyl)amide
-
-
pyridine-2-carboxylic acid ((S)-1-((1S,2S)-1-(4-bromobenzyloxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)ethylcarbamoyl]-2-hydroxypropylcarbamoyl)-2-methylpropyl)amide
-
-
pyridine-2-carboxylic acid ((S)-1-((1S,2S)-1-(biphenyl-3-ylmethoxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)-ethylcarbamoyl]-2-hydroxy-propylcar-bamoyl)-2-methyl-propyl)-amide
-
-
pyridine-2-carboxylic acid ((S)-1-((1S,2S)-1-(biphenyl-4-ylmethoxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)-ethylcarbamoyl]-2-hydroxy-propylcarbamoyl)-2-methyl-propyl)-amide
-
-
pyridine-2-carboxylic acid ((S)-1-((1S,2S)-1-benzyloxymethyl-3-[(S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)ethylcarbamoyl]-2-hydroxypropylcarbamoyl)-2-methylpropyl)amide
-
-
pyridine-2-carboxylic acid ((S)-1-((1S,2S)-3-((S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)ethylcarbamoyl)-2-hydroxy-1-phenethylpropylcarbamoyl)-2-methylpropyl)amide
-
-
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-1-(4-benzo-[1,3]dioxol-5-yl-benzyloxymethyl)-3-butylcarbamoyl-2-hydroxy-propylcarbamoyl]-2-methyl-propyl)-amide
-
-
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-1-(4-bromobenzyloxymethyl)-2-hydroxy-3-(2-phenylaminoethyl-carbamoyl)propylcarbamoyl]-2-methylpropyl)amide
-
-
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-1-(4-bromobenzyloxymethyl)-2-hydroxy-3-(3-phenylpropylcarbamoyl)propylcarbamoyl]-2-methylpropyl)amide
-
-
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-1-(4-bromobenzyloxymethyl)-3-(4-cyanobenzylcarbamoyl)-2-hydroxypropylcarbamoyl]-2-methylpropyl)amide
-
-
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-1-(4-bromobenzyloxymethyl)-3-(cyclohexylmethylcarbamoyl)-2-hydroxypropylcarbamoyl]-2-methylpropyl)amide
-
-
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-1-(4-bromobenzyloxymethyl)-3-butylcarbamoyl-2-hydroxypropylcarbamoyl]-2-methylpropyl)amide
-
-
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-1-(4-bromobenzyloxymethyl)-3-cyclohexylcarbamoyl-2-hydroxypropylcarbamoyl]-2-methylpropyl)amide
-
-
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-1-(biphenyl-4-ylmethoxymethyl)-3-butylcarbamoyl-2-hydroxy-propylcarbamoyl]-2-methylpropyl)-amide
-
-
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-3-butylcarbamoyl-2-hydroxy-1-(4-thiophen-3-yl-benzyloxymethyl)-propylcarbamoyl]-2-methyl-propyl)-amide
-
-
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)-ethylcarbamoyl]-2-hydroxy-1-(4-thiophen-3-yl-benzyloxymethyl)-propyl-carbamoyl]-2-methyl-propyl)-amide
-
-
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-3-[(S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)-ethylcarbamoyl]-2-hydroxy-1-(3-thiophen-3-yl-benzyloxymethyl)-propylcarbamoyl]-2-methylpropyl)-amide
-
-
pyridine-2-carboxylic acid((S)-1-[(1S,2S)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)-ethylcarbamoyl]-2-hydroxy-1-(4-thiophen-3-yl-benzyloxymethyl)-propyl-carbamoyl]-2-methyl-propyl)-amide
-
-
sodium lauryl sulfate
-
0.7 mM, 50% inhibition
Soybean trypsin inhibitor
-
-
-
tosylphenylalanylchloromethane
-
-
Val-D-Leu-Pro-Phe-Phe-Val-D-Leu
-
-
Vitamin A
-
-
Zn2+
-
0.01 M, slight decrease in activity
additional information
-
ACTIVATING COMPOUND
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
ATP
-
385.5% activity at 1 mM
DELTA9-tetrahydrocannabinol
-
at 10 nM, almost doubles enzyme activity in cell culture
H2O2
-
slight activation
KM VALUE [mM]
SUBSTRATE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
0.0037
(7-methoxycoumarin-4-yl)acetyl-Gly-Lys-Pro-Ile-Ile-Phe-Phe-Arg-Leu-Lys(Dnp)-D-Arg-NH2
-
40°C, pH 4.0, gastric cathepsin D
0.0022 - 0.00265
(7-methoxycoumarin-4-yl)acetyl-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2
0.00212
(7-methoxycoumarin-4-yl)acetyl-Gly-Ser-Ser-Ala-Phe-Leu-Ala-Phe-Lys(Dnp)-D-Arg-NH2
-
40°C, pH 4.0, gastric cathepsin D
0.00045
2-aminobenzoyl-AAKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00031
2-aminobenzoyl-AEKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00027
2-aminobenzoyl-AIAFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00017
2-aminobenzoyl-AIEFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00007
2-aminobenzoyl-AIFFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00005
2-aminobenzoyl-AIIFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00028
2-aminobenzoyl-AIKFFARQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00034
2-aminobenzoyl-AIKFFERQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00021
2-aminobenzoyl-AIKFFIRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.0003
2-aminobenzoyl-AIKFFKRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.0001
2-aminobenzoyl-AIKFFLRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00009
2-aminobenzoyl-AIKFFNRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00009
2-aminobenzoyl-AIKFFORQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00034
2-aminobenzoyl-AIKFFRRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00037
2-aminobenzoyl-AIKFFSA-(2,4-dinitrophenyl)-D
-
37°C, pH 4.0
0.00046
2-aminobenzoyl-AIKFFSAQ-N-(2,4-dinitrophenyl)ethylenediamine
0.0008
2-aminobenzoyl-AIKFFSAQTNR-(2,4-dinitrophenyl)-D
-
37°C, pH 4.0
0.00008
2-aminobenzoyl-AIKFFSAQTNRHILRFNR-(2,4-dinitrophenyl)-D
-
37°C, pH 4.0
0.0008
2-aminobenzoyl-AIKFFSAQTNRHILRFNRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.0008
2-aminobenzoyl-AIKFFSAQTNRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00066
2-aminobenzoyl-AIKFFSEQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00007
2-aminobenzoyl-AIKFFSIQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00055
2-aminobenzoyl-AIKFFSKQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00011
2-aminobenzoyl-AIKFFSLQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.0005
2-aminobenzoyl-AIKFFSNQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00066
2-aminobenzoyl-AIKFFSOQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00057
2-aminobenzoyl-AIKFFSPQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.0012
2-aminobenzoyl-AIKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00021
2-aminobenzoyl-AIKFFSSQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00043
2-aminobenzoyl-AIKFFSTQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.0001
2-aminobenzoyl-AIKFFSVQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00023
2-aminobenzoyl-AIKFFTRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00007
2-aminobenzoyl-AIKFFVRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00031
2-aminobenzoyl-AIKFMSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00041
2-aminobenzoyl-AIKLFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00028
2-aminobenzoyl-AIKLLSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00017
2-aminobenzoyl-AIKLMSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00016
2-aminobenzoyl-AIKMFLRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.001
2-aminobenzoyl-AIKMFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00076
2-aminobenzoyl-AIKMMSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00009
2-aminobenzoyl-AIKYSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00019
2-aminobenzoyl-AILFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00037
2-aminobenzoyl-AIMFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00081
2-aminobenzoyl-AINFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00085
2-aminobenzoyl-AIPFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00043
2-aminobenzoyl-AIQFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00032
2-aminobenzoyl-AISFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00086
2-aminobenzoyl-AITFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00017
2-aminobenzoyl-AIVFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00016
2-aminobenzoyl-AKKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00054
2-aminobenzoyl-ALKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00076
2-aminobenzoyl-ANKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00052
2-aminobenzoyl-APKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00082
2-aminobenzoyl-AQKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00096
2-aminobenzoyl-ASKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.0007
2-aminobenzoyl-ATKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00039
2-aminobenzoyl-AVKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00016
2-aminobenzoyl-KITLLSALVETRIVRFNRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
37°C, pH 4.0
0.00074
2-aminobenzoyl-KITLLSALVETRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
37°C, pH 4.0
0.00051 - 0.00094
2-aminobenzoyl-KITLLSAQ-N-(2,4-dinitrophenyl)ethylenediamine
3.2
7-methoxycoumarin-4-yl-GKPILFFRLK(2,4-dinitrophenyl)-D-Arg
-
pH 2.2, 30°C
1.7
7-methoxycoumarin-4-yl-SEVNLDAEFRK(2,4-dinitrophenyl)RR
-
pH 2.2, 30°C
0.62 - 1.1
EEISEVNLDAEFRG
0.0015
fibrinogen
-
-
-
1.6
Glu-Glu-His-Phe-Phe-Ala-Ala
-
-
1.1
Glu-Glu-His-Phe-Phe-Ala-Leu-methyl ester
-
-
0.0064 - 1.5
hemoglobin
-
0.1933
LLVVFF
-
at pH 3.7 and 37°C
0.394
LLVVYPWTQRFF
-
at pH 3.7 and 37°C
0.036 - 0.07
Lys-Pro-Ile-Glu-Phe-(4-nitro)Phe-Arg-Leu
0.0071
Phe-Ala-Ala-(4-nitro)Phe-Phe-Val-Leu-4-hydroxymethylpyridine ester
-
-
0.033
Phe-Gly-Gly-(4-nitro)Phe-Phe-Val-Leu-methyl ester
-
-
0.015 - 0.04
Pro-Pro-Thr-Ile-Phe-(4-nitro)Phe-Arg-Leu
0.0211
R[K-2,4-dinitrophenyl]LRFFLIPK[G-7-amido-4-methylcoumarin]
-
at pH 3.7 and 37°C
1.45 - 1.67
SEVNLDAEFR
0.0741
[aminooxy-acetyl-K]LLVVFF[D-PEG2]
-
at pH 3.7 and 37°C
additional information
additional information
-
TURNOVER NUMBER [1/s]
SUBSTRATE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
59.6
(7-methoxycoumarin-4-yl)acetyl-Gly-Lys-Pro-Ile-Ile-Phe-Phe-Arg-Leu-Lys(Dnp)-D-Arg-NH2
Rattus norvegicus
-
40°C, pH 4.0, gastric cathepsin D
2.2 - 2.5
(7-methoxycoumarin-4-yl)acetyl-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2
0.75
(7-methoxycoumarin-4-yl)acetyl-Gly-Ser-Ser-Ala-Phe-Leu-Ala-Phe-Lys(Dnp)-D-Arg-NH2
Rattus norvegicus
-
40°C, pH 4.0, gastric cathepsin D
2.6
2-aminobenzoyl-AAKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
6.18
2-aminobenzoyl-AEKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
16.3
2-aminobenzoyl-AIAFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
0.03 - 7.48
2-aminobenzoyl-AIEFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
0.47
2-aminobenzoyl-AIIFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
3.9
2-aminobenzoyl-AIKFFARQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
2.28 - 2.94
2-aminobenzoyl-AIKFFERQ-N-(2,4-dinitrophenyl)ethylenediamine
0.65
2-aminobenzoyl-AIKFFIRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
0.65
2-aminobenzoyl-AIKFFKRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
1.63 - 2.94
2-aminobenzoyl-AIKFFLRQ-N-(2,4-dinitrophenyl)ethylenediamine
0.98 - 6.08
2-aminobenzoyl-AIKFFNRQ-N-(2,4-dinitrophenyl)ethylenediamine
1.3
2-aminobenzoyl-AIKFFORQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
1.95
2-aminobenzoyl-AIKFFRRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
3.13 - 4.16
2-aminobenzoyl-AIKFFSA-(2,4-dinitrophenyl)-D
6.18 - 6.34
2-aminobenzoyl-AIKFFSAQ-N-(2,4-dinitrophenyl)ethylenediamine
0.99
2-aminobenzoyl-AIKFFSAQTNR-(2,4-dinitrophenyl)-D
Homo sapiens
-
37°C, pH 4.0
2.44 - 2.94
2-aminobenzoyl-AIKFFSAQTNRHILRFNR-(2,4-dinitrophenyl)-D
2.44 - 2.94
2-aminobenzoyl-AIKFFSAQTNRHILRFNRQ-N-(2,4-dinitrophenyl)ethylenediamine
0.99
2-aminobenzoyl-AIKFFSAQTNRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
3.13 - 3.58
2-aminobenzoyl-AIKFFSEQ-N-(2,4-dinitrophenyl)ethylenediamine
1.63 - 2.94
2-aminobenzoyl-AIKFFSIQ-N-(2,4-dinitrophenyl)ethylenediamine
1.3
2-aminobenzoyl-AIKFFSKQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
2.6
2-aminobenzoyl-AIKFFSLQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
3.25
2-aminobenzoyl-AIKFFSNQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
3.3 - 4.88
2-aminobenzoyl-AIKFFSOQ-N-(2,4-dinitrophenyl)ethylenediamine
1.3
2-aminobenzoyl-AIKFFSPQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
3.3 - 4.88
2-aminobenzoyl-AIKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
0.98 - 6.08
2-aminobenzoyl-AIKFFSSQ-N-(2,4-dinitrophenyl)ethylenediamine
2.6
2-aminobenzoyl-AIKFFSTQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
2.28 - 2.94
2-aminobenzoyl-AIKFFSVQ-N-(2,4-dinitrophenyl)ethylenediamine
1.63 - 2.94
2-aminobenzoyl-AIKFFTRQ-N-(2,4-dinitrophenyl)ethylenediamine
1.63 - 2.94
2-aminobenzoyl-AIKFFVRQ-N-(2,4-dinitrophenyl)ethylenediamine
1.3
2-aminobenzoyl-AIKFMSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
0.03 - 7.15
2-aminobenzoyl-AIKLFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
0.98 - 6.08
2-aminobenzoyl-AIKLLSRQ-N-(2,4-dinitrophenyl)ethylenediamine
2.28 - 2.94
2-aminobenzoyl-AIKLMSRQ-N-(2,4-dinitrophenyl)ethylenediamine
1.3
2-aminobenzoyl-AIKMFLRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
0.52
2-aminobenzoyl-AIKMFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
1.3
2-aminobenzoyl-AIKMMSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
2.6
2-aminobenzoyl-AIKYYSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
7.8
2-aminobenzoyl-AILFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
2.47 - 2.94
2-aminobenzoyl-AIMFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
8.45
2-aminobenzoyl-AINFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
0.081
2-aminobenzoyl-AIPFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
0.41
2-aminobenzoyl-AIQFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
0.04 - 8.78
2-aminobenzoyl-AISFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
5.53
2-aminobenzoyl-AITFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
0.84 - 6.08
2-aminobenzoyl-AIVFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
1.3
2-aminobenzoyl-AKKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
0.97
2-aminobenzoyl-ALKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
5.85
2-aminobenzoyl-ANKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
2.93 - 6
2-aminobenzoyl-APKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
2.28 - 2.94
2-aminobenzoyl-AQKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
0.65
2-aminobenzoyl-ASKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
pH 4.0, 37°C
3.13 - 3.58
2-aminobenzoyl-ATKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
0.04 - 8.78
2-aminobenzoyl-AVKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
0.17
2-aminobenzoyl-KITLLSALVETRIVRFNRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
37°C, pH 4.0
2.8
2-aminobenzoyl-KITLLSALVETRQ-N-(2,4-dinitrophenyl)ethylenediamine
Homo sapiens
-
37°C, pH 4.0
2.3 - 3.6
2-aminobenzoyl-KITLLSAQ-N-(2,4-dinitrophenyl)ethylenediamine
1.5 - 56.1
EEISEVNLDAEFRG
0.0014
fibrinogen
Homo sapiens
-
-
-
0.4
Glu-Glu-His-Phe-Phe-Ala-Ala
Homo sapiens
-
-
2.1
Glu-Glu-His-Phe-Phe-Ala-Leu-methyl ester
Homo sapiens
-
-
40 - 65
Lys-Pro-Ile-Glu-Phe-(4-nitro)Phe-Arg-Leu
2.9
Phe-Ala-Ala-(4-nitro)Phe-Phe-Val-Leu-4-hydroxymethylpyridine ester
Sus scrofa
-
-
0.6
Phe-Gly-Gly-(4-nitro)Phe-Phe-Val-Leu-methyl ester
Sus scrofa
-
-
25 - 95
Pro-Pro-Thr-Ile-Phe-(4-nitro)Phe-Arg-Leu
8.8 - 29
SEVNLDAEFR
additional information
2-aminobenzoyl-AEKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
Ki VALUE [mM]
INHIBITOR
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
0.035
(3S,4S)-5-(4-bromobenzyloxy)-3-hydroxy-4-(2-thiophen-2-ylacetylamino)pentanoic acid [(S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)ethyl]amide
-
-
0.1
(3S,4S)-5-(4-bromobenzyloxy)-4-(3,3-diphenylpropionylamino)-3-hydroxypentanoic acid [(S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)ethyl]amide
-
-
0.052
(3S,4S)-5-(4-bromobenzyloxy)-4-diphenylacetylamino-3-hydroxypentanoic acid [(S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)ethyl]amide
-
-
0.322
(S)-2,3-dihydro-1H-indole-2-carboxylic acid ((1S,2S)-1-(4-bromobenzyloxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)ethylcarbamoyl]-2-hydroxypropyl)amide
-
-
0.2
1,2-epoxy-3-(p-nitrophenoxy)-propane
-
pH 2.2, 30°C
0.00038
2-aminobenzoyl-AFKFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00015
2-aminobenzoyl-AIHFFSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.000054
2-aminobenzoyl-AIKFFHRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.000068
2-aminobenzoyl-AIKFFPRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.000093
2-aminobenzoyl-AIKFFSFQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00019
2-aminobenzoyl-AIKIISRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.000058
2-aminobenzoyl-AIKQQSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.00036
2-aminobenzoyl-AIKVVSRQ-N-(2,4-dinitrophenyl)ethylenediamine
-
pH 4.0, 37°C
0.0000032
cathepsin D inhibitor from Streptomyces sp.MBR04
-
in 0.02M sodium citrate, pH 3.0, at 37°C
-
0.5
Diazoacetyl-DL-norleucine methyl ester
-
pH 2.2, 30°C
20
Hg2+
-
-
0.00003
inhibitor isolated from potato
-
37°C, pH 3.1
-
0.00058
inhibitor isolated from tomato
-
37°C, pH 3.1
-
0.002701
N-((1S,2S)-1-(4-benzo[1,3]dioxol-5-yl-benzyloxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)-ethylcarbamoyl]-2-hydroxy-propyl)-2,4,6-trifluorobenzamide
-
-
1.807
N-((1S,2S)-1-(4-bromobenzyloxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)ethylcarbamoyl]-2-hydroxypropyl)-3,4-dichlorobenzamide
-
-
0.00173
N-((1S,2S)-1-(biphenyl-4-ylmethoxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)-ethylcarbamoyl]-2-hydroxy-propyl)-2,4,6-trifluorobenzamide
-
-
0.05
N-bromosuccinimide
-
-
0.0036
N-[(1S,2S)-1-(biphenyl-4-ylmethoxymethyl)-3-cyclo-hexylcarbamoyl-2-hydroxypropyl]-2,4,6-trifluorobenzamide
-
-
0.00494
N-[(1S,2S)-3-cyclohexylcarbamoyl-2-hydroxy-1-(4-thiophen-3-yl-benzyloxymethyl)-propyl]-2,4,6-trifluorobenzamide
-
-
0.00144
N-[(1S,2S)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butyl-carbamoyl)-ethylcarbamoyl]-2-hydroxy-1-(4-thiophen-3-yl-benzyloxymethyl)-propyl]-2,4,6-trifluorobenzamide
-
-
0.0000005 - 0.0000031
pepstatin A
0.01
potassium permanganate
-
-
0.041
pyridine-2-carboxylic acid ((R)-1-((1S,2S)-1-(4-bromobenzyloxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)ethylcarbamoyl]-2-hydroxypropylcarbamoyl)-2-methylpropyl)amide
-
-
0.000032
pyridine-2-carboxylic acid ((S)-1-((1S,2S)-1-(3-bromobenzyloxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)-ethylcarbamoyl]-2-hydroxypropylcarbamoyl)-2-methyl-propyl)-amide
-
-
0.0000007
pyridine-2-carboxylic acid ((S)-1-((1S,2S)-1-(4-benzo-[1,3]dioxol-5-yl-benzyloxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)-ethylcarbamoyl]-2-hydroxypropylcarbamoyl)-2-methylpropyl)-amide
-
-
0.14
pyridine-2-carboxylic acid ((S)-1-((1S,2S)-1-(4-bromobenzyloxymethyl)-2-hydroxy-3-(2-(3-methoxyphenyl)ethylcarbamoyl)propylcarbamoyl)-2-methylpropyl)amide
-
-
0.049
pyridine-2-carboxylic acid ((S)-1-((1S,2S)-1-(4-bromobenzyloxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)ethylcarbamoyl]-2-hydroxypropylcarbamoyl)-2-methylpropyl)amide
-
-
0.0000039
pyridine-2-carboxylic acid ((S)-1-((1S,2S)-1-(biphenyl-3-ylmethoxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)-ethylcarbamoyl]-2-hydroxy-propylcar-bamoyl)-2-methyl-propyl)-amide
-
-
0.0000025
pyridine-2-carboxylic acid ((S)-1-((1S,2S)-1-(biphenyl-4-ylmethoxymethyl)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)-ethylcarbamoyl]-2-hydroxy-propylcarbamoyl)-2-methyl-propyl)-amide
-
-
0.041
pyridine-2-carboxylic acid ((S)-1-((1S,2S)-1-benzyloxymethyl-3-[(S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)ethylcarbamoyl]-2-hydroxypropylcarbamoyl)-2-methylpropyl)amide
-
-
0.98
pyridine-2-carboxylic acid ((S)-1-((1S,2S)-3-((S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)ethylcarbamoyl)-2-hydroxy-1-phenethylpropylcarbamoyl)-2-methylpropyl)amide
-
-
0.000045
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-1-(4-benzo-[1,3]dioxol-5-yl-benzyloxymethyl)-3-butylcarbamoyl-2-hydroxy-propylcarbamoyl]-2-methyl-propyl)-amide
-
-
0.265
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-1-(4-bromobenzyloxymethyl)-2-hydroxy-3-(2-phenylaminoethyl-carbamoyl)propylcarbamoyl]-2-methylpropyl)amide
-
-
0.459
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-1-(4-bromobenzyloxymethyl)-2-hydroxy-3-(3-phenylpropylcarbamoyl)propylcarbamoyl]-2-methylpropyl)amide
-
-
0.623
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-1-(4-bromobenzyloxymethyl)-3-(4-cyanobenzylcarbamoyl)-2-hydroxypropylcarbamoyl]-2-methylpropyl)amide
-
-
0.586
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-1-(4-bromobenzyloxymethyl)-3-(cyclohexylmethylcarbamoyl)-2-hydroxypropylcarbamoyl]-2-methylpropyl)amide
-
-
0.473
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-1-(4-bromobenzyloxymethyl)-3-butylcarbamoyl-2-hydroxypropylcarbamoyl]-2-methylpropyl)amide
-
-
0.217
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-1-(4-bromobenzyloxymethyl)-3-cyclohexylcarbamoyl-2-hydroxypropylcarbamoyl]-2-methylpropyl)amide
-
-
0.000481
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-1-(biphenyl-4-ylmethoxymethyl)-3-butylcarbamoyl-2-hydroxy-propylcarbamoyl]-2-methylpropyl)-amide
-
-
0.000241
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-3-butylcarbamoyl-2-hydroxy-1-(4-thiophen-3-yl-benzyloxymethyl)-propylcarbamoyl]-2-methyl-propyl)-amide
-
-
0.0000032
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-3-[(S)-1-((S)-1-carbamoyl-3-methyl-butylcarbamoyl)-ethylcarbamoyl]-2-hydroxy-1-(4-thiophen-3-yl-benzyloxymethyl)-propyl-carbamoyl]-2-methyl-propyl)-amide
-
-
0.0000016
pyridine-2-carboxylic acid ((S)-1-[(1S,2S)-3-[(S)-1-((S)-1-carbamoyl-3-methylbutylcarbamoyl)-ethylcarbamoyl]-2-hydroxy-1-(3-thiophen-3-yl-benzyloxymethyl)-propylcarbamoyl]-2-methyl-propyl)-amide
-
-
0.7
sodium lauryl sulfate
-
-
IC50 VALUE [mM]
INHIBITOR
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
0.00021
(5Z)-5-[4-[(4-benzoyl-3-hydroxy-2-propylphenoxy)methyl]benzylidene]-2-thioxo-1,3-thiazolidin-4-one
Homo sapiens
-
at pH 5.5 and 37°C
0.0019
2-(3,4-dimethoxyphenyl)-N-[N-(4-methylbenzyl)carbamimidoyl]acetamide
Homo sapiens
-
at pH 5.5 and 37°C
0.000085
2-bromo-N-[(2S,3S)-4-[[2-(2,4-dichlorophenyl)ethyl][3-(1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)propanoyl]amino]-3-hydroxy-1-(3-phenoxyphenyl)butan-2-yl]-4,5-dimethoxybenzamide
Homo sapiens
-
at pH 5.5 and 37°C
0.00025
3,5-dichloro-2-[[(3,5-dichloro-2-hydroxyphenyl)sulfonyl]amino]-N-[4-[(6-ethoxy-1,3-benzothiazol-2-yl)sulfanyl]phenyl]benzamide
Homo sapiens
-
at pH 5.5 and 37°C
0.00017
3-cyclohexyl-N-(3,4-difluorobenzyl)-N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-D-alaninamide
Homo sapiens
-
at pH 5.5 and 37°C
0.00012
3-cyclohexyl-N-(3,4-dimethoxybenzyl)-N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-D-alaninamide
Homo sapiens
-
at pH 5.5 and 37°C
0.000098
3-cyclohexyl-N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-(3-fluoro-4-methoxybenzyl)-D-alaninamide
Homo sapiens
-
at pH 5.5 and 37°C
0.00017
3-cyclohexyl-N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-(4-fluoro-3-methoxybenzyl)-D-alaninamide
Homo sapiens
-
at pH 5.5 and 37°C
0.000092
3-cyclohexyl-N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[3-(1H-tetrazol-5-yl)benzyl]-D-alaninamide
Homo sapiens
-
at pH 5.5 and 37°C
0.000081
3-cyclohexyl-N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[3-fluoro-4-(1H-tetrazol-5-yl)benzyl]-D-alaninamide
Homo sapiens
-
at pH 5.5 and 37°C
0.000044
3-cyclohexyl-N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[4-(1H-tetrazol-5-yl)benzyl]-D-alaninamide
Homo sapiens
-
at pH 5.5 and 37°C
0.0000025
cathepsin D inhibitor from Streptomyces sp.MBR04
Homo sapiens
-
in 0.02M sodium citrate, pH 3.0, at 37°C
-
0.000067
N-(3,4-dimethoxybenzyl)-N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-D-leucinamide
Homo sapiens
-
at pH 5.5 and 37°C
0.000058
N-(3,4-dimethoxybenzyl)-Na-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-D-phenylalaninamide
Homo sapiens
-
at pH 5.5 and 37°C
0.0061
N-(N-benzylcarbamimidoyl)-2-(2-chloro-5-methoxyphenyl)acetamide
Homo sapiens
-
at pH 5.5 and 37°C
0.01
N-(N-benzylcarbamimidoyl)-2-(4,5-dimethoxy-2-nitrophenyl)acetamide
Homo sapiens
-
at pH 5.5 and 37°C
0.025
N-(N-benzylcarbamimidoyl)-3-(3,4-dimethoxyphenyl)propanamide
Homo sapiens
-
at pH 5.5 and 37°C
0.018
N-(N-benzylcarbamimidoyl)-4-(4,5-dimethoxy-2-nitrophenyl)butanamide
Homo sapiens
-
at pH 5.5 and 37°C
0.003
N-[N-(2-chlorobenzyl)carbamimidoyl]-2-(4,5-dimethoxy-2-nitrophenyl)acetamide
Homo sapiens
-
at pH 5.5 and 37°C
0.00044
N-[N-(3,4-dichlorobenzyl)carbamimidoyl]-2-(4,5-dimethoxy-2-nitrophenyl)acetamide
Homo sapiens
-
at pH 5.5 and 37°C
0.0027
N-[N-(3,4-dimethoxybenzyl)carbamimidoyl]-2-(4,5-dimethoxy-2-nitrophenyl)acetamide
Homo sapiens
-
at pH 5.5 and 37°C
0.029
N-[N-(4-aminobenzyl)carbamimidoyl]-2-(3,4-dimethoxyphenyl)acetamide
Homo sapiens
-
at pH 5.5 and 37°C
0.0015
N-[N-(4-chlorobenzyl)carbamimidoyl]-2-(4,5-dimethoxy-2-nitrophenyl)acetamide
Homo sapiens
-
at pH 5.5 and 37°C
0.0000086
N2-[N-[(2-bromo-4,5-dimethoxyphenyl)acetyl]carbamimidoyl]-3-cyclohexyl-N-(4-fluoro-3-methoxybenzyl)-D-alaninamide
Homo sapiens
-
at pH 5.5 and 37°C
0.00014
N2-[N-[(2-bromo-4,5-dimethoxyphenyl)acetyl]carbamimidoyl]-3-cyclohexyl-N-[3-(1H-tetrazol-5-yl)benzyl]-D-alaninamide
Homo sapiens
-
at pH 5.5 and 37°C
0.00024
N2-[N-[(2-bromo-4,5-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[3-(1H-tetrazol-5-yl)benzyl]-D-leucinamide
Homo sapiens
-
at pH 5.5 and 37°C
0.000024
N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-(4-fluoro-3-methoxybenzyl)-D-leucinamide
Homo sapiens
-
at pH 5.5 and 37°C
0.00028
N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[2-fluoro-3-(1H-tetrazol-5-yl)benzyl]-D-leucinamide
Homo sapiens
-
at pH 5.5 and 37°C
0.00037
N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[3-(1H-tetrazol-5-yl)benzyl]-D-leucinamide
Homo sapiens
-
at pH 5.5 and 37°C
0.00069
N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[3-fluoro-4-(1H-tetrazol-5-yl)benzyl]-D-leucinamide
Homo sapiens
-
at pH 5.5 and 37°C
0.00051
N2-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[4-(1H-tetrazol-5-yl)benzyl]-D-leucinamide
Homo sapiens
-
at pH 5.5 and 37°C
0.00032
Na-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[2-(1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)ethyl]-D-phenylalaninamide
Homo sapiens
-
at pH 5.5 and 37°C
0.0083
Na-[N-[(3,4-dimethoxyphenyl)acetyl]carbamimidoyl]-N-[2-(1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)ethyl]-L-phenylalaninamide
Homo sapiens
-
at pH 5.5 and 37°C