Information on EC - diacylglycerol kinase (ATP)

New: Word Map on EC
Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Specify your search results
Mark a special word or phrase in this record:
Select one or more organisms in this record:
Show additional data
Do not include text mining results
Include (text mining) results (more...)
Include results (AMENDA + additional results, but less precise; more...)

The expected taxonomic range for this enzyme is: Eukaryota, Bacteria

GeneOntology No.
diacylglycerol kinase (ATP)
ATP + 1,2-diacyl-sn-glycerol = ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacyl-sn-glycerol = ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
random equilibrium mechanism
ATP + 1,2-diacyl-sn-glycerol = ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
C-terminal active site comprises residues 371-501, the C1 domain is absolutely required for catalytic activity, residues Asp434, Asp650, Asp465, and Asp497 are involved
ATP + 1,2-diacyl-sn-glycerol = ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
catalytic and regulatory mechanisms
ATP + 1,2-diacyl-sn-glycerol = ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
conserved residues in the extended cysteine-rich domain CRD are essential for activity. e.g. G236, P244, and P245
ATP + 1,2-diacyl-sn-glycerol = ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
catalytic and regulatory mechanisms
Dictyostelium discoideum HL5
phospho group transfer
MetaCyc Link
phosphatidate metabolism, as a signaling molecule
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
IUBMB Comments
ATP:1,2-diacyl-sn-glycerol 3-phosphotransferase
Involved in synthesis of membrane phospholipids and the neutral lipid triacylglycerol. Activity is stimulated by certain phospholipids [4,7]. In plants and animals the product 1,2-diacyl-sn-glycerol 3-phosphate is an important second messenger. cf. EC, diacylglycerol kinase (CTP).
1,2-diacylglycerol kinase
adenosine 5'-triphosphate:1,2-diacylglycerol 3-phosphotransferase
arachidonoyl-specific diacylglycerol kinase
ATP:diacylglycerol phosphotransferase
DG kinase
DGK-3 diacylglycerol kinase
Dictyostelium discoideum HL5
diacylglycerol kinase
diacylglycerol kinase
diacylglycerol kinase (ATP dependent)
diacylglycerol kinase alpha
diacylglycerol kinase alpha
diacylglycerol kinase alpha
diacylglycerol kinase alpha
diacylglycerol kinase alpha
diacylglycerol kinase alpha
diacylglycerol kinase beta
diacylglycerol kinase beta
diacylglycerol kinase epsilon
diacylglycerol kinase eta
diacylglycerol kinase zeta
diacylglycerol kinase zeta
diacylglycerol kinase zeta
diacylglycerol kinase-alpha
diacylglycerol kinase-epsilon
diacylglycerol kinase-zeta
diacylglycerol kinase-zeta
diacylglycerol kinase-zeta
diacylglycerol:ATP kinase
diglyceride kinase
kinase (phosphorylating), 1,2-diacylglycerol
kinase, 1,2-diacylglycerol (phosphorylating)
sn-1,2-diacylglycerol kinase
2 isozymes DGK1 and DGK2
Manually annotated by BRENDA team
different splice forms
Manually annotated by BRENDA team
DGKtheta and DGKdelta
Manually annotated by BRENDA team
Dictyostelium discoideum HL5
strain HL5
Manually annotated by BRENDA team
9 different isozymes divided into 5 subtypes, alternative splicing of isozymes
Manually annotated by BRENDA team
; DGKgamma
Manually annotated by BRENDA team
Manually annotated by BRENDA team
Manually annotated by BRENDA team
DGKeta1 and DGKeta2
Manually annotated by BRENDA team
Manually annotated by BRENDA team
diacylglycerol kinase delta2
Manually annotated by BRENDA team
diacylglycerol kinase epsilon
Manually annotated by BRENDA team
isoform diacalglycerol kinase alpha
Manually annotated by BRENDA team
isoform diacalglycerol kinase zeta
Manually annotated by BRENDA team
isoform diaclyglycerol kinase epsilon
Manually annotated by BRENDA team
isoform diacylglycerol kinase delta
Manually annotated by BRENDA team
isoform diacylglycerol kinase delta
Manually annotated by BRENDA team
isoform diacylglycerol kinase delta. Female patient with a de novo balanced translocation, 46,X,t(X,2)(p11.2,q37)dn, who exhibits seizures, capillary abnormality, developmental delay, infantile hypotonia, and obesity
Manually annotated by BRENDA team
isoform diacylglycerol kinase epsilon
Manually annotated by BRENDA team
isoform diacylglycerolkinase epsilon
Manually annotated by BRENDA team
isoform diacylglycerolkinase zeta
Manually annotated by BRENDA team
isozyme theta
Manually annotated by BRENDA team
patients with bipolar disorder
Manually annotated by BRENDA team
9 different isozymes
Manually annotated by BRENDA team
9 different isozymes divided into 5 subtypes, alternative splicing of isozymes
Manually annotated by BRENDA team
Manually annotated by BRENDA team
DGKalpha isoform
Manually annotated by BRENDA team
DGKepsilon isoform
Manually annotated by BRENDA team
DGKzeta isoform
Manually annotated by BRENDA team
diacylglycerol kinase alpha
Manually annotated by BRENDA team
diacylglycerol kinase zeta
Manually annotated by BRENDA team
no activity in Saccharomyces cerevisiae
Manually annotated by BRENDA team
Manually annotated by BRENDA team
Manually annotated by BRENDA team
isoform alpha
Manually annotated by BRENDA team
isoform beta
Manually annotated by BRENDA team
isoform zeta
Manually annotated by BRENDA team
isoforms gamma, epsilon
Manually annotated by BRENDA team
isozymes DGKalpha, DGKzeta, and DGKepsilon
Manually annotated by BRENDA team
neuron-specific isozymes DGKbeta and DGKgamma
Manually annotated by BRENDA team
Manually annotated by BRENDA team
Manually annotated by BRENDA team
Sus scrofa DGKalpha
Manually annotated by BRENDA team
small interfering RNA-dependent knockdown of diacylglycerol kinase eta impairs the Ras/B-Raf/C-Raf/MEK/ERK pathway activated by epidermal growth factor in HeLa cells and inhibits cell proliferation
knockdown of DGKfzeta in cultured neurons decreases spine density
physiological function
neither overexpression of wild type nor kinase-inactive DGKzeta affects cell cycle distribution
physiological function
membrane localization of DGKalpha acts as a switch-off signal for Ras activation, mediated by localization to the membrane of Ras-GRP1, DGKalpha is a negative regulator of the T cell activation program, DGKalpha activity is required for optimal chemotactic response of neutrophils, whereas it halts their oxidative burst, DGKalpha is a negative modulator of diacylglycerol signaling, DGKalpha activity modulates the mTOR pathway to prevent cell cycle transition, DGKalpha is an indicator of cell quiescence, DGKalpha is a positive regulator of cell proliferation and migration
physiological function
membrane localization of DGKalpha acts as a switch-off signal for Ras activation, mediated by localization to the membrane of Ras-GRP1, DGKalpha is a negative regulator of the T cell activation program, DGKalpha activity is required for optimal chemotactic response of neutrophils, whereas it halts their oxidative burst, DGKalpha is a negative modulator of diacylglycerol signaling, DGKalpha activity modulates the mTOR pathway to prevent cell cycle transition, DGKalpha is an indicator of cell quiescence, DGKalpha is a positive regulator of cell proliferation and migration
physiological function
DGKepsilon prevents cardiac hypertrophy and progression to heart failure under chronic pressure overload
physiological function
DGKalpha has a central role in modulating T cell anergy through its ability to control DAG levels, which likely activates RasGRP1 and possibly other proteins; DGKzeta has an important biological function in the nucleus where it appears to modulate the cell cycle by metabolizing 1,2-diacylglycerol
physiological function
DGKs broadly regulate signaling events by virtue of their ability to provide 1,2-diacyl-sn-glycerol 3-phosphate (phosphatidic acid) for the synthesis of phosphatidylinositols
physiological function
DGKs broadly regulate signaling events by virtue of their ability to provide 1,2-diacyl-sn-glycerol 3-phosphate (phosphatidic acid) for the synthesis of phosphatidylinositols, isoform DGKzeta activates phosphatidylinositol-4-phosphate 5-kinase type Ialpha, DGKzeta modulates Rac1 activation to influence neurite outgrowth, DGKzeta modulates mTor activation and immune cell signaling
physiological function
DGKs broadly regulate signaling events by virtue of their ability to provide 1,2-diacyl-sn-glycerol 3-phosphate (phosphatidic acid) for the synthesis of phosphatidylinositols
physiological function
diacylglycerol kinase beta promotes dendritic outgrowth and spine maturation in developing hippocampal neurons
physiological function
isoform DGKepsilon interacts with actin stress fibers and is involved in their stability in vascular smooth muscle cells
physiological function
nuclear DGK-zeta downregulates the expression of cyclin D1 and increased the expression of TIS21/BTG2/PC3
physiological function
isoform DGKbeta is provided to perisynaptic sites of medium spiny neurons so that it can effectively produce 1,2-diacyl-sn-glycerol 3-phosphate upon activation of Gq protein-coupled receptors and modulate the cellular state of striatal output neurons
physiological function
isoform DGKalpha positively regulates tumor nuclear factor-alpha-dependent necrosis factor-kappaB activation via the protein kinase Czeta-mediated Ser311 phosphorylation of p65/RelA, isoform DGKalpha does not affect phosphorylation of IkappaB, DGKalpha enhances phosphorylation of p65 at Ser311 but not at Ser468 or Ser536
physiological function
isoform DGKalpha positively regulates tumor nuclear factor-alpha-dependent necrosis factor-kappaB activation via the protein kinase Czeta-mediated Ser311 phosphorylation of p65/RelA, isoform DGKalpha does not affect phosphorylation of IkappaB, DGKalpha enhances phosphorylation of p65 at Ser311 but not at Ser468 or Ser536
physiological function
overexpression of DGKeta1 can activate the Ras/B-Raf/C-Raf/MEK/ERK pathway in a DGK activity-independent manner, suggesting that DGKeta serves as a scaffold/adaptor protein, DGKeta activates C-Raf but not B-Raf
physiological function
isoform DGKf appears to form a multi-protein complex with functionally related proteins to organize efficient 1,2-diacylglycerol and 1,2-diacyl-sn-glycerol 3-phosphate signaling pathways at excitatory synapses, the DGKzeta isoform at excitatory postsynaptic sites is critically involved in spine maintenance, DGKzeta promotes neurite outgrowth
physiological function
diacylglycerol kinase zeta regulates actin cytoskeleton reorganization through dissociation of Rac1 from RhoGDI
physiological function
treating SKOV-3 ovarian cancer cell with a sphingosine analogue stimulates conversion of exogenous 1-alkyl-2-acetyl glycerol to alkyl-lysophosphatidic acid. Diacylglycerol kinase alpha may contribute significantly to the production of alkyl-lysophosphatidic acid in SKOV-3 cells, showing cross-talk between the sphingolipid and glycerol lipid pathways
physiological function
in response to cold temperatures, there is a very fast accumulation of phosphatidic acid in Arabidopsis seedlings and leaf discs. Radiolabeling studies indicate a dominant role of diacylglycerol kinase under these conditions
physiological function
endogenous isoform diacylglycerol kinase alpha is recruited to the T cell receptor complex following T cell receptor/CD28 engagement; endogenous isoform diacylglycerol kinase zeta is recruited to the T cell receptor complex following T cell receptor/CD28 engagement. Specific diacylglycerol kinase gene silencing shows that phosphatidic acid production at the activated complex depends mainly on diacylglycerol kinase zeta. At early stages of T cell immunological synapse formation, isoform zeta translocates rapidly to the plasma membrane, where rapid, sustained diacylglycerol accumulation is found
?=not specified
1,2-dipalmitoyl-sn-glycerol + GTP
GDP + 1,2-dipalmitoyl-sn-glycerol 3-phosphate
show the reaction diagram
1,2-dipalmitoyl-sn-glycerol + GTP
GDP + 1,2-dipalmitoyl-sn-glycerol 3-phosphate
show the reaction diagram
2'-deoxy-ATP + sn-1,2-dihexanoylglycerol
2'-deoxy-ADP + sn-1,2-dihexanoylglycerol 3-phosphate
show the reaction diagram
ADP + sn-1,2-dihexanoylglycerol
AMP + sn-1,2-dihexanoylglycerol 3-phosphate
show the reaction diagram
MgADP- is a very poor phosphoryl donor
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
enzyme is more active toward long-chain diacylglycerol compared with short-chain diacylglycerol
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the enzyme functions to recycle diacylglycerol which is generated largely as a by-product of membrane-derived oligosaccharide biosynthesis
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the enzyme may regulate the intracellular concentration of diacylglycerol
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the enzyme is involved in resynthesis of phosphatidylinositol by converting a second messenger diacylglycerol to phosphatidic acid
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
DGKiota may have important cellular functions in retina and brain
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
DAGKalpha is stimulated vby Src-like kinase-dependent phosphoinositide 3 kinase activation in lymphocytes. In vivo the increase in cellular levels of Src-like kinase-dependent phosphoinositide 3 kinase products is sufficient to induce DAGKalpha activation, allowing DAGKalpha relocation to the intact lymphocyte
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
nuclear DGK-theta is activated in response to alpha-thrombin
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the enzyme plays a role in cellular processes by regulating the intracellular concentration of the second messenger diacylglycerol. DGKeta may play a more general role in regulating cellular diacylglycerol levels
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the expression of DGKeta2 is suppressed by glucocorticoid in contrast to the marked induction of DGKeta1
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
high level expression of DGKalpha is induced following a signal transmitted through the pre-T-cell-receptor and the protein tyrosine kinase lck. Activity of DGKalpha contributes to survival in CD4+ 8+ double positive thymocytes as pharmacological inhibition of DGK activity results in death of this cell population both in cell suspension and thymic explants. DGKalpha promotes survival in theses thymocytes through a Bcl-regulated pathway
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the enzyme may have an important function in the adult nervous system and muscle and during the development of the embryonic nervous system
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
DGK-Ialpha is involved in IL-2-mediated lymphocyte proliferation
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the 80000 Da and the 150000 Da enzyme form do not possess specificity towards diacylglycerol molecular species
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
DGKgamma negatively regulates macrophage differentiation through its catalytic action operating on the cytoskeleton
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
i.e. phosphatidic acid
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
i.e. phosphatidic acid
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
i.e. phosphatidic acid
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
i.e. phosphatidic acid
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
i.e. phosphatidic acid
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
i.e. phosphatidic acid
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
i.e. phosphatidic acid
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
1,2-diacyl-sn-glycerol 3-phosphate is phosphatidic acid
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
reaction takes place during stimulated phosphatidylinositol turnover
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
second messenger and intermediate in lipid synthesis
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
termination of diacylglycerol signaling, isozymes DGKalpha, DGKbeta, and DGKgamma play a pivotal role in development and metabolism of brain
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the enzyme binds and regulates signalling proteins which are activated by either diacylglycerol or phosphatidic acid
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the enzyme binds and regulates signalling proteins which are activated by either diacylglycerol or phosphatidic acid, isozyme dgk-1 regulates diacylglycerol signalling required for acetylcholine release
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
1,2-diacylglycerol is a second messenger
i.e. phosphatidic acid
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
DGKepsilon exhibits specificity for diacylglcerol substrates containing an arachidonoyl chain in the sn-2 position
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
Dictyostelium discoideum HL5
ATP + 1,2-diarachidonoyl-glycerol
ADP + 1,2-diarachidonoyl-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diarachidonoyl-sn-glycerol
ADP + 1,2-diarachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-dicapryl-sn-glycerol
ADP + 1,2-dicapryl-sn-glycerol 3-phosphate
show the reaction diagram
about 140% of the activity with sn-1,2-dioleoylglycerol
ATP + 1,2-didecanoylglycerol
ADP + 1,2-didecanoylglycerol 3-phosphate
show the reaction diagram
enzyme type I: activity is 157% of the activity with rac-1,2-dioleoylglycerol, enzyme type II: activity is 141% of the activity with rac-1,2-dioleoylglycerol
ATP + 1,2-didodecanoylglycerol
ADP + 1,2-didodecanoylglycerol 3-phosphate
show the reaction diagram
enzyme type I: activity is 107% of the activity with rac-1,2-dioleoylglycerol, enzyme type II: activity is 227% of the activity with rac-1,2-dioleoylglycerol
ATP + 1,2-dihexadecanoylglycerol
ADP + 1,2-dihexadecanoylglycerol 3-phosphate
show the reaction diagram
enzyme type I: activity is 198% of the activity with rac-1,2-dioleoylglycerol, enzyme type II: activity is 231% of the activity with rac-1,2-dioleoylglycerol
ATP + 1,2-dihexanoyl-sn-glycerol
ADP + 1,2-dihexanoyl-sn-glycerol 3-phosphate
show the reaction diagram
Dictyostelium discoideum, Dictyostelium discoideum HL5
ATP + 1,2-dihexanoylglycerol
ADP + 1,2-dihexanoylglycerol 3-phosphate
show the reaction diagram
ATP + 1,2-dilinoleoyl-sn-glycerol
ADP + 1,2-dilinoleoyl-sn-glycerol
show the reaction diagram
ATP + 1,2-dioctanoyl-sn-glycerol
ADP + 1,2-dioctanoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-dioctanoyl-sn-glycerol
ADP + 1,2-dioctanoyl-sn-glycerol 3-phosphate
show the reaction diagram
Dictyostelium discoideum, Dictyostelium discoideum HL5
preferred substrate
ATP + 1,2-dioctanoylglycerol
ADP + 1,2-dioctanoylglycerol 3-phosphate
show the reaction diagram
ATP + 1,2-dioctanoylglycerol
ADP + 1,2-dioctanoylglycerol 3-phosphate
show the reaction diagram
enzyme type I: activity is 149% of the activity with rac-1,2-dioleoylglycerol, enzyme type II: activity is 114% of the activity with rac-1,2-dioleoylglycerol
ATP + 1,2-dioleoyl-sn-glycerol
ADP + 1,2-dioleoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-dioleoyl-sn-glycerol
ADP + 1,2-dioleoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-dioleoyl-sn-glycerol
ADP + 1,2-dioleoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-dioleoyl-sn-glycerol
ADP + 1,2-dioleoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-dioleoyl-sn-glycerol
ADP + 1,2-dioleoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-dioleoyl-sn-glycerol
ADP + 1,2-dioleoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-dioleoyl-sn-glycerol
ADP + 1,2-dioleoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-dioleoyl-sn-glycerol
ADP + 1,2-dioleoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-dioleoyl-sn-glycerol
ADP + 1,2-dioleoyl-sn-glycerol 3-phosphate
show the reaction diagram
isoform DGKepsilon shows about 7% activity with 0.38 mol% 1,2-dioleoyl-sn-glycerol compared to 1-stearoyl-2-arachidonoyl-sn-glycerol
ATP + 1,2-dioleoyl-sn-glycerol
ADP + 1,2-dioleoyl-sn-glycerol 3-phosphate
show the reaction diagram
about 15fold the rate of 1-O-hexadecyl-sn-glycerol phosphorylation, isoforms diacylglycerol kinase alpha, beta, gamma, delta1, delta1, zeta, jota, theta
ATP + 1,2-dioleoyl-sn-glycerol
ADP + 1,2-dioleoyl-sn-glycerol 3-phosphate
show the reaction diagram
Dictyostelium discoideum HL5
ATP + 1,2-dioleoyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-dipalmitoyl-sn-glycerol
ADP + 1,2-dipalmitoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-dipalmitoyl-sn-glycerol
ADP + 1,2-dipalmitoyl-sn-glycerol 3-phosphate
show the reaction diagram
15% of the activity with 1-stearoyl-2-arachidonoyl-sn-glycerol
ATP + 1,2-ditetradecanoylglycerol
ADP + 1,2-ditetradecanoylglycerol 3-phosphate
show the reaction diagram
enzyme type I: activity is 200% of the activity with rac-1,2-dioleoylglycerol, enzyme type II: activity is 262% of the activity with rac-1,2-dioleoylglycerol
ATP + 1,3-dioleoyl-sn-glycerol
ADP + 1,3-dioleoyl-sn-glycerol 2-phosphate
show the reaction diagram
low activity, about 4% of the activity with 1,2-dioleoyl-sn-glycerol
ATP + 1-arachidoyl-2-arachidonoyl-sn-glycerol
ADP + ?
show the reaction diagram
isoform DGKepsilon shows about 70% activity with 0.38 mol% 1-arachidoyl-2-arachidonoyl-sn-glycerol compared to 1-stearoyl-2-arachidonoyl-sn-glycerol
ATP + 1-O-hexadecyl-2-oleoyl-sn-glycerol
ADP + 1-O-hexadecyl-2-oleoyl-sn-glycerol 3-phosphate
show the reaction diagram
45.4% of the activity with 1-stearoyl-2-arachidonoyl-sn-glycerol
ATP + 1-O-hexadecyl-2-sn-acetyl glycerol
ADP + 1-O-hexadecyl-2-sn-acetyl glycerol 3-phosphate
show the reaction diagram
about 12fold the rate of 1-O-hexadecyl-sn-glycerol phosphorylation, isoforms diacylglycerol kinase alpha, beta, gamma, delta1, delta1, zeta, jota, theta
ATP + 1-O-hexadecyl-sn-glycerol
ADP + 1-O-hexadecyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1-O-hexanoyl-2-arachidonoyl-sn-glycerol
ADP + 1-O-hexanoyl-2-arachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
preferred by isozyme DGKzeta and isozyme DGKalpha
ATP + 1-O-hexanoyl-2-oleoyl-sn-glycerol
ADP + 1-O-hexanoyl-2-oleoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1-oleoyl-2-palmitoyl-sn-glycerol
ADP + 1-palmitoyl-2-oleoyl-sn-glycerol 3-phosphate
show the reaction diagram
about 85% of the activity with sn-1,2-dioleoylglycerol, DGKksi
ATP + 1-palmitoyl-2-arachidonoyl-sn-glycerol
ADP + 1-palmitoyl-2-arachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
enzyme type I: activity is 181% of the activity with rac-1,2-dioleoylglycerol, enzyme type II: activity is 116% of the activity with rac-1,2-dioleoylglycerol
ATP + 1-palmitoyl-2-arachidonoyl-sn-glycerol
ADP + 1-palmitoyl-2-arachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
isoform DGKepsilon shows about 90% activity with 0.38 mol% 1-palmitoyl-2-arachidonoyl-sn-glycerol compared to 1-stearoyl-2-arachidonoyl-sn-glycerol
ATP + 1-palmitoyl-2-linoleoyl-sn-glycerol
ADP + 1-palmitoyl-2-linoleoyl-sn-glycerol 3-phosphate
show the reaction diagram
enzyme type I: activity is 116% of the activity with rac-1,2-dioleoylglycerol, enzyme type II: activity is 86% of the activity with rac-1,2-dioleoylglycerol
ATP + 1-palmitoyl-2-oleoyl-sn-glycerol
ADP + 1-palmitoyl-2-oleoyl-sn-glycerol 3-phosphate
show the reaction diagram
about 60% of the activity with 1-palmitoyl-2-arachidonoyl-sn-glycerol
ATP + 1-palmitoyl-2-oleoyl-sn-glycerol
ADP + 1-palmitoyl-2-oleoyl-sn-glycerol 3-phosphate
show the reaction diagram
96.5% of the activity with 1-stearoyl-2-arachidonoyl-sn-glycerol
ATP + 1-palmitoyl-2-oleoyl-sn-glycerol
ADP + 1-palmitoyl-2-oleoyl-sn-glycerol 3-phosphate
show the reaction diagram
about 80% of the activity with sn-1,2-dioleoylglycerol, about 80% of the activity with sn-1,2-dioleoylglycerol, DGKksi
ATP + 1-stearoyl-2-arachidonoyl-sn-glycerol
ADP + 1-stearoyl-2-arachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1-stearoyl-2-arachidonoyl-sn-glycerol
ADP + 1-stearoyl-2-arachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1-stearoyl-2-arachidonoyl-sn-glycerol
ADP + 1-stearoyl-2-arachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1-stearoyl-2-arachidonoyl-sn-glycerol
ADP + 1-stearoyl-2-arachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1-stearoyl-2-arachidonoyl-sn-glycerol
ADP + 1-stearoyl-2-arachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1-stearoyl-2-arachidonoyl-sn-glycerol
ADP + 1-stearoyl-2-arachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1-stearoyl-2-arachidonoyl-sn-glycerol
ADP + 1-stearoyl-2-arachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
108% of the activity with sn-1,2-dioleoylglycerol
ATP + 1-stearoyl-2-arachidonoyl-sn-glycerol
ADP + 1-stearoyl-2-arachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
since diacylglycerol kinase is an enzyme of the phosphatidylinositol cycle, its natural substrate could be 1-stearoyl-2-arachidonoyl-sn-glycerol, thought to be the main diacylglycerol analog generated from phosphoinositide
ATP + 1-stearoyl-2-arachidonoyl-sn-glycerol
ADP + 1-stearoyl-2-arachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
about 110% of the activity with 1,2-dioleoyl-sn-glycerol
ATP + 1-stearoyl-2-arachidonoyl-sn-glycerol
ADP + 1-stearoyl-2-arachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
preferred substrate of isoform diacylglycerol kinase epsilon
ATP + 1-stearoyl-2-arachidonoyl-sn-glycerol
ADP + 1-stearoyl-2-arachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
isoform DGKepsilon shows 100% activity with 0.38 mol% 1-stearoyl-2-arachidonoyl-sn-glycerol
ATP + 1-stearoyl-2-arachidonoyl-sn-glycerol
ADP + 1-stearoyl-2-arachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
in wild-type, ratio of enzymic activity of substrates 1-stearoyl-2-linoleoyl-sn-glycerol to 1-stearoyl-2-arachidonoyl-sn-glycerol is 0.109
ATP + 1-stearoyl-2-docosahexaenoyl-sn-glycerol
ADP + 1-stearoyl-2-docosahexaenoyl-sn-glycerol
show the reaction diagram
no substrate for wild-type, but substrate for mutant R457Q
ATP + 1-stearoyl-2-linoleoyl-sn-glycerol
ADP + 1-stearoyl-2-linoleoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1-stearoyl-2-linoleoyl-sn-glycerol
ADP + 1-stearoyl-2-linoleoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1-stearoyl-2-linoleoyl-sn-glycerol
ADP + 1-stearoyl-2-linoleoyl-sn-glycerol 3-phosphate
show the reaction diagram
in wild-type, ratio of enzymic activity of substrates 1-stearoyl-2-linoleoyl-sn-glycerol to 1-stearoyl-2-arachidonoyl-sn-glycerol is 0.109
ATP + 1-stearoyl-2-oleoyl-sn-glycerol
ADP + 1-stearoyl-2-oleoyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 2,3-dioleoyl-sn-glycerol
ADP + 2,3-diacyl-sn-glycerol 1-phosphate
show the reaction diagram
ATP + 2,3-dioleoyl-sn-glycerol
ADP + 2,3-diacyl-sn-glycerol 1-phosphate
show the reaction diagram
ATP + 2,3-dioleoyl-sn-glycerol
ADP + 2,3-diacyl-sn-glycerol 1-phosphate
show the reaction diagram
isoform diacylglycerol kinase alpha 8.5%, zeta, 12%, epsilon 6% of the activity with 1,2-dioleoyl-sn-glycerol, respectively
ATP + 2-arachidonoyl-sn-glycerol
ADP + 2-arachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
isoform DGKepsilon shows substrate specificity for sn-2 arachidonoyl-diacylglycerol
ATP + 2-monooleoyl-rac-glycerol
ADP + 2-monooleoyl-rac-glycerol 3-phosphate
show the reaction diagram
10.7% of the activity with 1-stearoyl-2-arachidonoyl-sn-glycerol
ATP + ceramide
ADP + ceramide 3-phosphate
show the reaction diagram
ATP + ceramide
ADP + ceramide 3-phosphate
show the reaction diagram
ATP + ceramide
ADP + ceramide 3-phosphate
show the reaction diagram
ATP + ceramide
ADP + ceramide 3-phosphate
show the reaction diagram
no activity
ATP + ceramide
ADP + ceramide 3-phosphate
show the reaction diagram
hardly utilized
ATP + rac-1,2-dioleoylglycerol
ADP + rac-1,2-dioleoylglycerol 3-phosphate
show the reaction diagram
ATP + sn-1,2-dihexanoylglycerol
ADP + sn-1,2-dihexanoylglycerol 3-phosphate
show the reaction diagram
ATP + sn-1,2-dioctanoylglycerol
ADP + sn-1,2-dioctanoylglycerol 3-phosphate
show the reaction diagram
ATP + sn-1,2-dioleoylglycerol
ADP + sn-1,2-dioleoylglycerol 3-phosphate
show the reaction diagram
ATP + sn-1,2-dioleoylglycerol
ADP + sn-1,2-dioleoylglycerol 3-phosphate
show the reaction diagram
ATP + sn-1,2-dioleoylglycerol
ADP + sn-1,2-dioleoylglycerol 3-phosphate
show the reaction diagram
ATP + sn-1,2-dioleoylglycerol
ADP + sn-1,2-dioleoylglycerol 3-phosphate
show the reaction diagram
ATP + sn-1,2-dioleoylglycerol
ADP + sn-1,2-dioleoylglycerol 3-phosphate
show the reaction diagram
ATP + sn-1,2-dioleoylglycerol
ADP + sn-1,2-dioleoylglycerol 3-phosphate
show the reaction diagram
ATP + sn-1,2-dioleoylglycerol
ADP + sn-1,2-dioleoylglycerol 3-phosphate
show the reaction diagram
ATP + sn-1,2-dioleoylglycerol
ADP + sn-1,2-dioleoylglycerol 3-phosphate
show the reaction diagram
ATP + sn-1,2-dioleoylglycerol
ADP + sn-1,2-dioleoylglycerol 3-phosphate
show the reaction diagram
ATP + sn-1,2-dioleoylglycerol
ADP + sn-1,2-dioleoylglycerol 3-phosphate
show the reaction diagram
ATP + sn-1,2-dioleoylglycerol
ADP + sn-1,2-dioleoylglycerol 3-phosphate
show the reaction diagram
recombinant DGKksi
ATP + sn-1,2-dioleoylglycerol
ADP + sn-1,2-dioleoylglycerol 3-phosphate
show the reaction diagram
enzyme type I: activity is 18% of the activity with rac-1,2-dioleoylglycerol, enzyme type II: activity is 19% of the activity with rac-1,2-dioleoylglycerol
ATP + sn-1,3-dioleoylglycerol
ADP + ?
show the reaction diagram
about 10% of the activity with sn-1,2-dioleoylglycerol
GTP + dioleoylglycerol
GDP + dioleoylglycerol 3-phosphate
show the reaction diagram
GTP + sn-1,2-dihexanoylglycerol
GDP + sn-1,2-dihexanoylglycerol 3-phosphate
show the reaction diagram
ITP + sn-1,2-dihexanoylglycerol
IDP + sn-1,2-dihexanoylglycerol 3-phosphate
show the reaction diagram
additional information
sn-1,3-dioleoylglycerol is not a substrate
additional information
enzyme form I and II show a preference for diacylglycerol substrates with saturated acyl chains of 10-12 carbon atoms
additional information
no activity with ficaprenol
additional information
diacylglycerol emulsion
additional information
the enzyme is active in mixed micelles containing octyl glucoside and dioleoylglycerol
additional information
complex enzyme regulation involving alternative splicing, overview, the enzyme is involved in several processes such as cell growth, neuronal transmission, and cytoskeleton remodeling
additional information
complex enzyme regulation, overview, the enzyme is involved in several processes such as cell growth, neuronal transmission, and cytoskeleton remodeling
additional information
the enzyme inhibits neurotransmission to control behaviour by terminating diacylglycerol signaling, probably independent of Galpha0 signaling
additional information
the isozyme DGK2 is involved in cold signal transduction
additional information
the isozyme zeta interacts with phosphoinositol phosphate 5-kinase activating it via phosphatidic acid, isozyme theta associates with RhoA, complex enzyme regulation involving alternative splicing, overview, the enzyme is involved in several processes such as cell growth, neuronal transmission, and cytoskeleton remodeling
additional information
1-oleoyl-rac-glycerol is a poor substrate
additional information
isozymes DGKzeta, DGKalpha, and DGKepsilon utilize 1-alkyl-2-acyl-glycerols as substrates, addition of cholesterol and/or phosphatidylethanolamine reduce the substrate specificity
additional information
DGK-3 affects the resetting of the thermal memory by altering plasticity in the temperature range of AFD synaptic output, without detectably affecting plasticity in the temperature range of AFD temperature sensitivity
additional information
DGKzeta blocks cardiac hypertrophic programs in response to endothelin-1 in neonatal rat cardiomyocytes. DGKzeta blocks cardiac hypertrophy induced by G protein-coupled receptor agonists and pressure overload in vivo. DGKzeta attenuates ventricular remodeling and improves survival after myocardial infarction
additional information
diacylglycerol kinase alpha suppresses tumor necrosis factor-alpha-induced apoptosis of human melanoma cells through NF-kappaB activation
additional information
diacylglycerol kinase delta regulates protein kinase C and epidermal growth factor receptor signaling
additional information
diacylglycerol kinase gamma interacts with and activates beta2-chimaerin, a Rac-specific GAP, in response to epidermal growth factor
additional information
diacylglycerol kinase zeta plays a role in modulation of membrane trafficking. DGKzeta depletion in JURKAT cells accelerates transferrin receptor exit from the endocytic recycling compartment
additional information
diacylglycerol kinase zeta regulates microbial recognition and host resistance to Toxoplasma gondii
additional information
nuclear DGKgamma regulates cell cycle
additional information
nuclear diacylglycerol kinase-zeta is a negative regulator of cell cycle progression in C2C12 mouse myoblasts
additional information
phospholipase C/diacylglycerol kinase-mediated signalling is required for benzothiadiazole-induced oxidative burst and hypersensitive cell death in rice suspension-cultured cells
additional information
Rv2252 encodes a diacylglycerol kinase involved in the biosynthesis of phosphatidylinositol mannosides
additional information
T cell anergy is reversed by active Ras and is regulated by diacylglycerol kinase-alpha
additional information
the enzyme plays a role in the secretion of lethal exosomes bearing Fas ligand during activation-induced cell death of T lymphocytes
additional information
the soluble diacylglycerol kinase DgkB is required for lipoteichoic acid production in Bacillus subtilis
additional information
activation of a Ca2+-independent protein kinase C isozyme by 1,2-diacylglycerol, which is generated by phospholipase Cbeta and phospholipase D activation and inactivated by phosphorylation via diacylglycerol kinase, is responsible for the endothelin-1-induced decreases in Ca2+ transients and cell shortening
additional information
diacylglycerol kinase alpha is involved in secretion of pro-apoptotic protein Fas ligand by T-lymphocytes via the regulation of the release of lethal exosomes by the exocytic pathway
additional information
diacylglycerol kinase gamma regulates beta2-chimaerin, a GTPase-activating protein for Rac
additional information
diacylglycerol kinase is involved in the regulation of oxidative stress-induced intestinal cell injury
additional information
diacylglycerol kinase zeta and syntrophins play a role at multiple stages of the cell fusion process. Potential link between changes in the lipid content of the membranebilayer and reorganization of the actin cytoskeleton during myoblast fusion
additional information
diacylglycerol kinase zeta is a key determinant of cell cycle progression and differentiation of C2C12 cells
additional information
diacylglycerol kinase zeta is involved in control of vesicle trafficking
additional information
diacylglycerol kinases alpha and zeta synergistically promote T cell maturation in the thymus
additional information
diacylglycerol kinases are required for anchorage-independent growth in MDA-MB-231 cells
additional information
no substrate: monoacylglycerol, ceramide, or undecaprenol
additional information
1,2-diacylglycerol embedded in unilamellar dioleoyl-phosphatidylcholine vesicles is not a substrate for DgkB
additional information
2-arachidonoyl glycerol is a very poor substrate for the epsilon isoform of diacylglycerol kinases. 2-Oleoyl glycerol is also a poor substrate for this isoform of diacylglycerol kinases
additional information
2-arachidonoyl glycerol is a very poor substrate for the zeta isoforms of diacylglycerol kinases. 2-Oleoyl glycerol is also a poor substrate for this isoform
additional information
alkyl-lysophosphatidic acid can be produced in SKOV-3 cells by diacylglycerol kinase-mediated phosphorylation of 1-O-hexadecyl-sn-2-acetyl glycerol followed by deacetylation of 1-O-hexadecyl-sn-2-acetyl glycerol 3-phosphate. Production of alkyl-lysophosphatidic acid is stimulated by sphingosine and its analogues
additional information
the cholesterol recognition/interaction amino acid consensus domain adjacent to the lipoxygenase-like motif plays a role in acyl-chain selectivity. Despite the high degree of conservation of the amino acid sequence in this region of the protein, certain mutations result in proteins with higher activity than the wild-type protein. These mutations also result in a selective gain of acyl-chain preferences for diacylglycerols with different acyl-chain profiles. In addition to the lipoxygenase-like motif, adjacent residues also contribute to selectivity for diacylglycerols with specific acyl-chain compositions
additional information
water does not compete with diacylglycerol as an acceptor of the gamma-phosphate of ATP. Neither with the highly specific substrate, 1-stearoyl-2-arachidonoyl-sn-glycerol, nor with a less specific substrate, 1-stearoyl-2-linoleoyl-sn-glycerol, is there any evidence for ATP hydrolysis accompanying substrate phosphorylation
?=not specified
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the enzyme functions to recycle diacylglycerol which is generated largely as a by-product of membrane-derived oligosaccharide biosynthesis
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the enzyme may regulate the intracellular concentration of diacylglycerol
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the enzyme is involved in resynthesis of phosphatidylinositol by converting a second messenger diacylglycerol to phosphatidic acid
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
DGKiota may have important cellular functions in retina and brain
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
DAGKalpha is stimulated vby Src-like kinase-dependent phosphoinositide 3 kinase activation in lymphocytes. In vivo the increase in cellular levels of Src-like kinase-dependent phosphoinositide 3 kinase products is sufficient to induce DAGKalpha activation, allowing DAGKalpha relocation to the intact lymphocyte
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
nuclear DGK-theta is activated in response to alpha-thrombin
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the enzyme plays a role in cellular processes by regulating the intracellular concentration of the second messenger diacylglycerol. DGKeta may play a more general role in regulating cellular diacylglycerol levels
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the expression of DGKeta2 is suppressed by glucocorticoid in contrast to the marked induction of DGKeta1
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
high level expression of DGKalpha is induced following a signal transmitted through the pre-T-cell-receptor and the protein tyrosine kinase lck. Activity of DGKalpha contributes to survival in CD4+ 8+ double positive thymocytes as pharmacological inhibition of DGK activity results in death of this cell population both in cell suspension and thymic explants. DGKalpha promotes survival in theses thymocytes through a Bcl-regulated pathway
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the enzyme may have an important function in the adult nervous system and muscle and during the development of the embryonic nervous system
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
DGK-Ialpha is involved in IL-2-mediated lymphocyte proliferation
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the 80000 Da and the 150000 Da enzyme form do not possess specificity towards diacylglycerol molecular species
ATP + 1,2-diacyl-sn-glycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
DGKgamma negatively regulates macrophage differentiation through its catalytic action operating on the cytoskeleton
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
reaction takes place during stimulated phosphatidylinositol turnover
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
second messenger and intermediate in lipid synthesis
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
termination of diacylglycerol signaling, isozymes DGKalpha, DGKbeta, and DGKgamma play a pivotal role in development and metabolism of brain
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the enzyme binds and regulates signalling proteins which are activated by either diacylglycerol or phosphatidic acid
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
the enzyme binds and regulates signalling proteins which are activated by either diacylglycerol or phosphatidic acid, isozyme dgk-1 regulates diacylglycerol signalling required for acetylcholine release
ATP + 1,2-diacylglycerol
ADP + 1,2-diacyl-sn-glycerol 3-phosphate
show the reaction diagram
Dictyostelium discoideum HL5
ATP + 1-stearoyl-2-arachidonoyl-sn-glycerol
ADP + 1-stearoyl-2-arachidonoyl-sn-glycerol 3-phosphate
show the reaction diagram
since diacylglycerol kinase is an enzyme of the phosphatidylinositol cycle, its natural substrate could be 1-stearoyl-2-arachidonoyl-sn-glycerol, thought to be the main diacylglycerol analog generated from phosphoinositide
additional information
complex enzyme regulation involving alternative splicing, overview, the enzyme is involved in several processes such as cell growth, neuronal transmission, and cytoskeleton remodeling
additional information
complex enzyme regulation, overview, the enzyme is involved in several processes such as cell growth, neuronal transmission, and cytoskeleton remodeling
additional information
the enzyme inhibits neurotransmission to control behaviour by terminating diacylglycerol signaling, probably independent of Galpha0 signaling
additional information
the isozyme DGK2 is involved in cold signal transduction
additional information
the isozyme zeta interacts with phosphoinositol phosphate 5-kinase activating it via phosphatidic acid, isozyme theta associates with RhoA, complex enzyme regulation involving alternative splicing, overview, the enzyme is involved in several processes such as cell growth, neuronal transmission, and cytoskeleton remodeling
additional information
DGK-3 affects the resetting of the thermal memory by altering plasticity in the temperature range of AFD synaptic output, without detectably affecting plasticity in the temperature range of AFD temperature sensitivity
additional information
DGKzeta blocks cardiac hypertrophic programs in response to endothelin-1 in neonatal rat cardiomyocytes. DGKzeta blocks cardiac hypertrophy induced by G protein-coupled receptor agonists and pressure overload in vivo. DGKzeta attenuates ventricular remodeling and improves survival after myocardial infarction
additional information
diacylglycerol kinase alpha suppresses tumor necrosis factor-alpha-induced apoptosis of human melanoma cells through NF-kappaB activation
additional information
diacylglycerol kinase delta regulates protein kinase C and epidermal growth factor receptor signaling
additional information
diacylglycerol kinase gamma interacts with and activates beta2-chimaerin, a Rac-specific GAP, in response to epidermal growth factor
additional information
diacylglycerol kinase zeta plays a role in modulation of membrane trafficking. DGKzeta depletion in JURKAT cells accelerates transferrin receptor exit from the endocytic recycling compartment
additional information
diacylglycerol kinase zeta regulates microbial recognition and host resistance to Toxoplasma gondii
additional information
nuclear DGKgamma regulates cell cycle
additional information
nuclear diacylglycerol kinase-zeta is a negative regulator of cell cycle progression in C2C12 mouse myoblasts
additional information
phospholipase C/diacylglycerol kinase-mediated signalling is required for benzothiadiazole-induced oxidative burst and hypersensitive cell death in rice suspension-cultured cells
additional information
Rv2252 encodes a diacylglycerol kinase involved in the biosynthesis of phosphatidylinositol mannosides
additional information
T cell anergy is reversed by active Ras and is regulated by diacylglycerol kinase-alpha
additional information
the enzyme plays a role in the secretion of lethal exosomes bearing Fas ligand during activation-induced cell death of T lymphocytes
additional information
the soluble diacylglycerol kinase DgkB is required for lipoteichoic acid production in Bacillus subtilis
additional information
activation of a Ca2+-independent protein kinase C isozyme by 1,2-diacylglycerol, which is generated by phospholipase Cbeta and phospholipase D activation and inactivated by phosphorylation via diacylglycerol kinase, is responsible for the endothelin-1-induced decreases in Ca2+ transients and cell shortening
additional information
diacylglycerol kinase alpha is involved in secretion of pro-apoptotic protein Fas ligand by T-lymphocytes via the regulation of the release of lethal exosomes by the exocytic pathway
additional information
diacylglycerol kinase gamma regulates beta2-chimaerin, a GTPase-activating protein for Rac
additional information
diacylglycerol kinase is involved in the regulation of oxidative stress-induced intestinal cell injury
additional information
diacylglycerol kinase zeta and syntrophins play a role at multiple stages of the cell fusion process. Potential link between changes in the lipid content of the membranebilayer and reorganization of the actin cytoskeleton during myoblast fusion
additional information
diacylglycerol kinase zeta is a key determinant of cell cycle progression and differentiation of C2C12 cells
additional information
diacylglycerol kinase zeta is involved in control of vesicle trafficking
additional information
diacylglycerol kinases alpha and zeta synergistically promote T cell maturation in the thymus
additional information
diacylglycerol kinases are required for anchorage-independent growth in MDA-MB-231 cells
absolute requirement for a divalent ion. Mg2+ is more effective than Mn2+ or Ca2+
2 mol of Ca2+ per mol of enzyme. Ca2+ plus phosphatidylserine markedly activates by reducing the Km value for ATP
DGK I: good activator, DGK IV: activation with 1 mM CaCl2 is comparable to that obtained on presence of MgCl2
plus phosphatidylserine, activates enzyme DGK-Igamma
plus phosphatidylserine, activates enzyme DGK-Ibeta
plus phosphatidylserine, activates enzyme DGK-Ialpha
activity is independent of Ca2+, dissociation constant is 0.00044 mM, hydrophobic region of the enzyme is masked by addition of Ca2+; enzyme can bind approximately 2 mol of Ca2+ per mol
activity is independent of Ca2+, dissociation constant is 0.00089 mM, binding of Ca2+ results in exposure of hydrophobic amino acids; enzyme can bind approximately 2 mol of Ca2+ per mol
enzyme can bind approximately 2 mol of Ca2+ per mol; enzyme requires Ca2+, dissociation constant is 0.0099 mM, hydrophobic region of the enzyme is masked by addition of Ca2+
activates in vitro, interacts via N-terminal RVH motif and EF hands
dependent on, maximal below 0.01 mM
dependent on, isozymes DGKalpha, DGKbeta, and DGKgamma
isoform diacylglycerol kinase alpha requires Ca2+
Ca2+ requirement in DGKalpha activation
Ca2+ requirement in DGKalpha activation
activates; activates; activates
enzyme requires a free divalent metal cation: Mg2+, Mn2+, Co2+, Cd2+ or Zn2+
when Mg2+ is excluded from the assay, Cd2+ supports activity to lesser extent
enzyme requires a free divalent metal cation: Mg2+, Mn2+, Co2+, Cd2+ or Zn2+
when Mg2+ is excluded from the assay, Co2+ supports activity to lesser extent
absolute requirement for a divalent ion. Mg2+ is more effective than Mn2+ or Ca2+. 50% stimulation by 0.4 mM Mg2+, maximal activity at 5-40 mM
enzyme requires a free divalent metal cation: Mg2+, Mn2+, Co2+, Cd2+ or Zn2+
divalent cation is required for activity. Mg2+ is most effective, maximal activation at about 10 mM
the enzyme is dependent on
DGK I: maximal activation at 20 mM. DGK IV: maximal activation at 5 mM
required, optimal activity at 2.5 mM for DGK-I, 5.0 mM for DGK-II and 10.0 mM for DGK-III
required, maximal activity at 3 mM MgCl2, half-maximal activity at around 1 mM
required, optimal activity of microsomal enzyme at 2 mM, optimal activity of soluble enzyme at 10 mM
a second Mg2+ in addition to MgATP is required for activity
coordidating bivalent metal ion is involved in substrate binding
dependent on
at 10 mM MgCl2
structure reveals a Mg2+ site and an associated Asp-water-Mg2+ network
required for activity, interfacial binding of DgkB requires a Mg2+-dependent conformational change
required for activity
absolute requirement for a divalent ion. Mg2+ is more effective than Mn2+ or Ca2+. Mn2+ is more effective on the enzyme from microtubule than on the enzyme from supernatant
enzyme requires a free divalent metal cation: Mg2+, Mn2+, Co2+, Cd2+ or Zn2+. Ka for Mg2+ is 3.4 mM
slight activation at 5 mM
DGK I: activation is not so great as with MgCl2. Maximal stimulation at 0.1 mM. DGK IV: activation is 10fold less than with MgCl2
Mg2+ requirement can be partially substituted by Mn2+
the enzyme contains two zinc fingers
the sterile alpha motif domain of diacylglycerol kinase delta binds zinc at multiple sites, driving the organization of the enzyme into large sheets of polymers. A mutant enzyme containing a sterile alpha motif domain refractory to zinc binding diminishes the formation of cytoplasmic puncta, shows partially impaired regulation of transport to the plasma membrane, and lacks the ability to inhibit the formation of CopII coated vesicles
enzyme requires a free divalent metal cation: Mg2+, Mn2+, Co2+, Cd2+ or Zn2+
when Mg2+ is excluded from the assay, Zn2+ supports activity to lesser extent
when Mg2+ is excluded from the assay, Mn2+ supports activity to lesser extent
additional information
effects of liposome composition on substrate specificity and catalytic activity level of the isozymes
additional information
neither Ca2+, Mn2+, nor Zn2+ is able to effectively replace Mg2+, although Ca2+ and Mn2+ support a few percent activity
1,2-diarachidonoyl phosphatidic acid
about 55% relative activity in the presence of 1.5 mol%
1-arachidoyl-2-arachidonoyl phosphatidic acid
about 70% relative activity in the presence of 1.5 mol%
1-palmitoyl-2-arachidonoyl phosphatidic acid
about 50% relative activity in the presence of 1.5 mol%
1-stearoyl-2-arachidonoyl phosphatidic acid
about 48% relative activity in the presence of 1.5 mol%
1-stearoyl-2-oleoyl phosphatidic acid
about 70% relative activity in the presence of 1.5 mol%
uncompetitive inhibition of isoforms diacylglycerol kinase alpha and zeta, no inhibition of isoform epsilon. Binds to a site on the alpha and zeta isoforms that is exposed as a consequence of the substrate binding to the active site, the chiral specificity of the isoforms thus mimicks the substrate specificity
2-arachidonoyl glycerol
inhibitor for both of the epsilon or the zeta isoforms of diacylglycerol kinase; inhibitor for both of the epsilon or the zeta isoforms of diacylglycerol kinase
2-oleoyl glycerol
inhibits diacylglycerol kinase epsilon less than does 2-arachidonoyl glycerol; shows similar inhibitory potency for diacylglycerol kinase zeta as 2-arachidonoyl glycerol
0.5 mM, 5% inhibition of DGK I and 28% inhibition of DGK IV
adenosine 5'-tetraphosphoryl-3-O-(1,2-dihexanoyl)-sn-glycerol
0.5 mM, 77% inhibition of DGK I and 66% inhibition of DGK IV
apparent binding parameters of diacylglycerol kinase theta increase following alpha-thrombin stimulation
0.5 mM, 18% inhibition of DGK I and 14% inhibition of DGK IV
antineutrophil cytoplasmic antibody
selective activation of diacylglycerol kinase
0.5 mM, 93% inhibition of DGK I and 71% inhibition of DGK IV
0.5 mM, 20% inhibition of DGK I and 15% inhibition of DGK IV
0.5 mM, 43% inhibition of DGK I and 28% inhibition of DGK IV
0.5 mM, 42% inhibition of DGK I and 9% inhibition of DGK IV
0.5%, 30% inhibition
1 mM, about 50% inhibition
above 3.4 mol%, substrate inhibition
above 3.4 mol%
above 3.4 mol%
0.5%, 20% inhibition
0.5 mM, 74% inhibition of DGK I and 72% inhibition of DGK IV
0.5 mM, 74% inhibition of DGK I and 56% inhibition of DGK IV
0.5 mM, 37% inhibition of DGK I and 32% inhibition of DGK IV
endogenous nuclear diacylglycerol kinase zeta rapidly translocates to the cytoplasm following H2O2 treatment
induces the interaction of diacylglycerol kinase gamma with beta2-chimaerin. Simultaneous addition of H2O2 and phorbol myristate acetate synergistically enhances the interaction with concomitant translocation of beta2-chimaerin from cytoplasm to the plasma membrane
more than 50% inhibition at above 200 mM
0.5%, 45% inhibition
octyl glucoside
enzyme form DGK-I, DGK-II and DGK-III
phorbol ester
activation of protein kinase C which inhibits diacylglycerol kinase epsilon binding to retinoblastoma protein. Mimicking of protein kinase C phosphorylation of serine residues by S/D mutations but not S/N mutations within the MARCKS phosphorylation site domain also prevents binding to retinoblastoma protein
phorbol myristate acetate
induces the interaction of diacylglycerol kinase gamma with beta2-chimaerin. Simultaneous addition of H2O2 and phorbol myristate acetate synergistically enhances the interaction with concomitant translocation of beta2-chimaerin from cytoplasm to the plasma membrane
phosphatidic acid
competitive inhibition
enzyme form DGK-I, DGK-II and DGK-III
inhibits phosphatidylcholine-dependent kinase activity
2.5 mol% results in 50% inhibition of the phosphatidylcholine-dependent kinase activity
phosphatidylinositol 4,5-bisphosphate
potent inhibitor
potent inhibitor; potent inhibitor
0.1 mM, 41% inhibition of DGK I and 15% inhibition of DGK IV
inhibits the 80000 Da enzyme form but not the 150000 Da enzyme form
inhibits DGK-II and to a lesser extent DGK-III, but little affects DGK-I
specific inhibitor
specifc inhibitor of diacylglycerol kinase. Treatment significantly increases glucose transport, p38 and MKK3/6 activation in myotubes. The R59022-induced glucose transport is blocked by SB203580, a specific p38 inhibitor. R59022 fails to stimulate both possible known mechanisms to enhance glucose transport, an IRS1-PI3K-Akt pathway, muscle contraction signaling or GLUT1 and GLUT4 expression
inhibition of diacylglycerol kinase decreases H2O2-induced RIE-1 cell apoptosis
decrease in total diacylglycerol kinase activity and increases in diacylglycerol levels upon incubation of skeletal muscle, with parallel increase in protein kinase C activity and isoform-specific phosphorylation of protein kinase Cdelta. Diacylglycerol kinase inhibition also reduces insulin-stimulated glucose transport
pre-treatment increases both carbamoylcholine-induced and phytohemagglutinin-induced apoptosis due to an increase in the release of exosomes bearing non-processed pro-apoptotic protein FasL
decrease in total diacylglycerol kinase activity and increases in diacylglycerol levels upon incubation of skeletal muscle, with parallel increase in protein kinase C activity and isoform-specific phosphorylation of protein kinase Cdelta. Diacylglycerol kinase inhibition also reduces insulin-stimulated glucose transport
inhibition of diacylglycerol kinase activity accompanied by increased protein kinase Calpha activity, reduced glucose-induced insulin receptor activation, and GLUT4 translocation. Inhibition of decrease in the intracellular levels of diacylglycerol upon exposure of L6 cells to glucose
specific inhibition of diacylglycerol kinase alpha. Inhibition impairs impairs hepatocyte growth factor- and v-Src-induced cell scatter and migration, without affecting the loss of intercellular adhesions, impairs hepatocyre growth factor-induced cell spreading, lamellipodia formation, membrane ruffling, and focal adhesions remodeling and impairs hepatocyte growth factor-induced Rac activation and membrane targeting
DGKalpha inhibitor
V14-RhoA, strong binding to the C-terminal catalytic domain, negative regulation
Sodium deoxycholate
at 5 mM
inhibits the 150000 Da enzyme
stimulation results in an increase in the apparent KM of DGKtheta at low concentrations of substrate dioleoylglycerol. Increasing the bulk concentration of dioleoylglycerol returns the apparent KM to the basal value
Triton N-101
0.5%, 45% inhibition
Triton N-101
enzyme form DGK-I, DGK-II and DGK-III
Triton N-101
Triton X-100
extremely inhibitory to the 80000 Da enzyme and the 150000 Da enzyme form
Triton X-100
0.5 mM, 50% inhibition
Triton X-100
strong inhibition at up to 2%
more than 50% inhibition at above 200 mM
additional information
addition of cholesterol and/or phosphatidylethanolamine reduce the substrate specificity
additional information
isozyme DGK2 activity is affected by salts and detergents, no inhibition by Ca2+
analogue of FTY720, 0.01 mM increase phosphorylation of 1-O-hexadecyl-sn-2-acetyl glycerol by isoform diacylglycerol kinase alpha about 3.5fold.
half-maximal activation at 21.9 mol%
enhances voltage-dependent opening of wild-type and cAMP/H+-uncoupled hyperpolarization activated, cyclic nucleotide-regulated channels. 4beta-Phorbol-12-myristate-13-acetate exerts its effects on channel gating via sequential activation ofprotein kinase C and diacylglycerol kinase coupled with upregulation of mitogen-activated protein kinase and phospholipase A2
acidic phospholipids
activation in vitro
activation of the expression of diacylglycerol kinase OsDAGK1
bis-phosphatidic acid
half-maximal activation at 3.9 mol%
stimulates nuclear diacylglycerol kinase catalytic activity
mitochondrial, half-maximal activation at 2.3 mol%
good activator
half-maximal activation by 1 mol%
DGKalpha can be activated in vitro in a Ca2+-independent manner by lipids such cholesterol
DGKalpha can be activated in vitro in a Ca2+-independent manner by lipids such cholesterol
cholesterol 3-sulfate
exposure of L6 cell myotubes overexpressing human insulin receptors to 25 mM glucose for 5 min decreases the intracellular levels of diacylglycerol, paralleled by transient activation of diacylglycerol kinase and of insulin receptor signaling. Following 30-min exposure, both diacylglycerol levels and diacylglycerol kinase activity return close to basal levels. Glucose exposure redistributes diacylglycerol kinase isoforms alpha and delta, from the prevalent cytosolic localization to the plasma membrane fraction
purified enzyme is completely devoid of activity without addition of phospholipid or deoxycholate
the enzyme shows optimal activity in presence of phosphatidylserine or deoxycholate. Lower activity in presence of phosphatidylcholine. Diacylglycerol analogs containing an unsaturated fatty acid at the sn-2 position give optimal enzyme activity irrespective of the presence of deoxycholate
enhances activity of enzyme form DGK-II and DGK-III, enzyme form DGK-I is not much affected
enhances activity
no activity in absence of detergent
half-maximal activation at 13.5 mol%
diacylglycerol 3-phosphate
the enzyme apoprotein is attributed to a novel feedback activation involving diacylglycerol 3-phosphate
half-maximal activation at 11.9 mol%
dioleoyl ethylene glycol
half-maximal activation at 10.4 mol%
half-maximal activation at 6.3 mol%
dipalmitoylphosphatidic acid
activates only in presence of Triton X-100
activates diacylglycerol kinase in caveolae/rafts and noncaveolae/rafts of mesenteric arteries. Activation does not depend on phosphatidylinositol 3-kinase. In response to norepinephrin, but not to epithelin-1, protein kinase PKB translocates to caveolae/rafts
in presence of 0.01 mM FTY720, phosphorylation of 1-O-hexadecyl-sn-2-acetyl glycerol by isoforms diacylglycerol kinase alpha, beta or gamma is 3fold increased
endogenous nuclear diacylglycerol kinase zeta rapidly translocates to the cytoplasm following H2O2 treatment
hepatocyte growth factor
induces diaclyglycerol kinase activity, which is required for cell invasiveness
hexadecyl phosphorylcholine
half-maximal activation at 17.3 mol%
lauryl maltoside
activates in presence of 11 mM Triton X-100
purified enzyme is completely inactive unless a lipid is added to the assay buffer containing Triton X-100
activation of phospholipids in the order of decreasing efficiency: phosphatidylcholine, lysophosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, sphingomyelin
myristoylcholine chloride
myristyl acetate
n-hexyl beta-D-glucoside
activates in presence of 11 mM Triton X-100
stimulates an increase in diacylglycerol kinase activity in caveolae/rafts of mesenteric arteries. Activation depends on phosphatidylinositol 3-kinase. In response to norepinephrin, but not to epithelin-1, protein kinase PKB translocates to caveolae/rafts
octyl acetate
octyl beta-glucoside
activates in presence of 11 mM Triton X-100
oleic acid
activates only in presence of Triton X-100
oleoylcholine chloride
p53 activates DGKalpha in response to DNA damage
p53 activates DGKalpha in response to DNA damage
palmitic acid
activates only in presence of Triton X-100
diacylglycerol kinase zeta activity at the T cell receptor is enhanced by phorbol-12-myristate-13-acetate cotreatment
phosphatidic acid
activates only in presence of Triton X-100
phosphatidic acid
good activator of DGK IV, no effect on DGK I activity
phosphatidic acid
highly stimulating
phosphatidic acid
more effective activator than phosphatidylserine. Phosphatidic acid decreases the apparent surface KM of DGKtheta for dioleoylglycerol and promotes binding to vesicles in a dose-dependent manner; phosphatidic acid is more effective than phosphatidiylserine. Both decreases the apparent surface KM value for dioleoylglycerol and promote binding to vesicles, but through different mechanisms
phosphatidic acid
production of oxidative burst and hypersensitive cell death. Activation of the epxression of diacylglycerol kinase and transcritional factor gene OsBIERF3. Neomycin partially inhibits the poduction of oxidatve burst, hypersensitive cell death, and expression of both genes
phosphatidyl glycerol
good activator
the enzyme shows optimal activity in presence of phosphatidylserine or deoxycholate. Lower activity in presence of phosphatidylcholine
moderate enhancement of DGK IV, no effect on DGK I activity
enzyme type II has a preference for phosphatidylcholine as cofactor, enzyme type I can utilize both phosphatidylserine and phosphatidylinositol, but has a lower preference for phosphatidylcholine
activation of phospholipids in the order of decreasing efficiency: phosphatidylcholine, lysophosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, sphingomyelin
phosphatidylcholine plasmalogen
half-maximal activation at 7.3 mol%
activates only in presence of Triton X-100
plus cardiolipin, activates
activation of phospholipids in the order of decreasing efficiency: phosphatidylcholine, lysophosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, sphingomyelin
DGKalpha can be activated in vitro in a Ca2+-independent manner by lipids such as phosphatidylethanolamine
DGKalpha can be activated in vitro in a Ca2+-independent manner by lipids such as phosphatidylethanolamine
effective stimulation
effective stimulation
enhances activity of DGK I and DGK IV
enzyme type II has a preference for phosphatidylcholine as cofactor, enzyme type I can utilize both phosphatidylserine and phosphatidylinositol, but has a lower preference for phosphatidylcholine
phosphatidylinositol 4,5-bisphosphate
highly stimulating
the enzyme shows optimal activity in presence of phosphatidylserine or deoxycholate. Lower activity in presence of phosphatidylcholine
good activator
enhances activity of DGK I and DGK IV
enzyme type II has a preference for phosphatidylcholine as cofactor, enzyme type I can utilize both phosphatidylserine and phosphatidylinositol, but has a lower preference for phosphatidylcholine
activation of phospholipids in the order of decreasing efficiency: phosphatidylcholine, lysophosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, sphingomyelin
10-20 mol% result in 7.5-7.8fold activation of the recombinant wild-type enzyme, 3.8fold of the recombinant mutant DELTA196, and 6.5fold of the recombinant mutant DELTA332
strong activation
less effective activator than phosphatidic acid. Phosphatidylserine decreases the apparent surface KM of DGKtheta for dioleoylglycerol; phosphatidic acid is more effective than phosphatidiylserine. Both decreases the apparent surface KM value for dioleoylglycerol and promote binding to vesicles, but through different mechanisms
purified enzyme is completely devoid of activity without addition of phospholipid or deoxycholate
activation by phospholipid is not stereospecific and is mimicked partially by fatty acids
enhances activity. Activation of phospholipids in the order of decreasing efficiency: phosphatidylcholine, lysophosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, sphingomyelin
a combination of diacylglycerol and phospholipid exclusively leads to full activation
platelet-activating factor
half-maximal activation at 22.4 mol%
half-maximal activation at 2.7 mol%
Sodium cholate
enhances activity of DGK I and DGK IV
Sodium deoxycholate
enhances activity of DGK I and DGK IV
Sodium dodecyl sulfate
sodium hexadecyl sulfate
half-maximal activation at 9.8 mol%
activation of phospholipids in the order of decreasing efficiency: phosphatidylcholine, lysophosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, sphingomyelin
potently activates the 80000 Da enzyme
in presence of 0.01 mM sphingosine, phosphorylation of 1-O-hexadecyl-sn-2-acetyl glycerol by isoforms diacylglycerol kinase alpha, beta or gamma is 7-9fold increased
stearic acid
activates only in presence of Triton X-100
half-maximal activation at 15.8 mol%
Triton X-100
methyl myristate
additional information
serotonin signalling activates the enzyme
additional information
the isozyme DGK2 is induced by exposure to low temperatures, e.g. 4C
additional information
DGKzeta interacts with and is regulated by the retinoblastoma protein
pH 7.4, 30C, enzyme form DGK I
pH 7.4, 30C, enzyme form DGK IV
pH 7.5, 30C
pH 7.5, 25C
pH 7.4, 30C, enzyme form DGK I
pH 7.4, 30C, enzyme form DGK IV
pH 6.8, 30C, reaction with sn-2,3-dihexanoylglycerol
about, pH 6.8, 30C, reaction with sn-2,3-dihexanoylglycerol
pH 7.5, 25C
pH 7.5, 25C
pG 7.4, 30C, enzyme type I
pH 7.4, 30C, in presence of 1,2-dioleoylglycerol, enzyme form DGK I
wild-type protein, FLAG-tag, pH 7.2, 25C
mutant C46A/C113A, pH 6.9, 25C
N-terminally trucated protein, FLAG-tag, pH 7.2, 25C
pH 7.4, 30C, enzyme form DGK-I
pH 6.6, 30C
pH 7.0, 37C, microsomal enzyme
pH 7.0, 37C, soluble enzyme
wild-type protein with C-terminal His-tag, pH 7.2, 25C
pH 7.4, 30C, enzyme form DGK-II
pH 7.4, 30C, in presence of 1,2-dioleoylglycerol, enzyme form DGK IV
pH 7.4, 30C
wild-type, pH 6.9, 25C
mutant C46A/C113A/Q33C, pH 6.9, 25C
pH 7.4, 30C, enzyme form DGK-III
pH 7.5, 30C, without deoxycholate
pG 7.4, 30C, enzyme type II
mutant C46A/C113A/E34C, pH 6.9, 25C
mutant C46A/C113A/A29C, pH 6.9, 25C
mutant C46A/C113A/E28C, pH 6.9, 25C
pH 6.6, 25C
pH 7.5, 30C, with 1 mM deoxycholate
mutant C46A/C113A/F31C, pH 6.9, 25C
pH 6.8, 30C, reaction with sn-2,3-dihexanoylglycerol
mutant C46A/C113AA30C, pH 6.9, 25C
mutant C46A/C113A/R32C, pH 6.9, 25C
pH 6.6, 25C
pH 7.5, 25C
pH 7.4, 30C, enzyme form DGK-I
pH 7.4, 30C, enzyme form DGK-II
pH 7.4, 30C, enzyme form DGK-III
pH 7.5, 25C
pH 6.6, 30C
pH 7.5, 25C
pH 7.0, 37C, soluble enzyme
pH 7.0, 37C, microsomal enzyme
pH 6.8, 30C, reaction with sn-2,3-dihexanoylglycerol
pH 6.8, 30C, reaction with sn-2,3-dihexanoylglycerol
wild-type enzyme
mutant enzyme E76L
mutant enzyme E69C
mutant enzyme N72S
mutant enzyme A14Q
mutant enzyme K94V
pH 7.4, 30C, enzyme form DGK IV
pH 7.4, 30C, enzyme form DGK I
mutant enzyme D95N
additional information
additional information
Km for dioleoylglycerol is 0.92 mol%
additional information
additional information
in presence of Triton X-100, used for purification, a biphasic dependency upon diacylglycerol is observed and the apparent Michaelis constant values for diacylglycerol decreases with decreasing Triton concentration
additional information
additional information
additional information
additional information
Km-values are 0.92 mol% for dioleoylglycerol and 3.6 mol% for dioctanoylglycerol
additional information
additional information
additional information
additional information
kinetics, recombinant wild-type and mutant enzymes
additional information
additional information
Km values of isozymes DGKzeta, DGKepsilon, and DGKalpha with different substrates in mol%
additional information
additional information
kinetics, follow a Michaelis-Menten mechanism in case of medium-chain diacylglycerols, and are strongly dependent on detergent concentration and sort used in the micelles in the assay in case of longer-chain substrates showing sigmoidal kinetics, overview
additional information
additional information
turnover numbers of full-length DGKepsilon with a C-terminal His tag, full-length FLAG-DGKepsilon and truncated FLAG-DGKepsilon
additional information
additional information
KMapp for substrate 1,2-dioleoyl-sn-glycerol is 0.9 mol% in presence of 1% phosphatidic acid, 0.6 mol% in presence of 9% phosphatidylserine, and 8.0 mol% without additive
additional information
additional information
Km-value in mol% for wild-type 9.2, mutant C46A/C113A 4.9, mutant C46A/C113A/E28C 5.7, mutant C46A/C113A/A29C 7.4, mutant C46A/C113AA30C 27.2, mutant C46A/C113A/F31C 17.2, mutant C46A/C113A/R32C 12.9, mutant C46A/C113A/Q33C 12.1, mutant C46A/C113A/E34C 13.7
additional information
additional information
Km value in mol% for substrate 1,2-dioleoylglycerol is 0.8 for isoform alpha, 0.52 for isoform zeta, pH 7.2, 30C
additional information
additional information
Km value for wild-type is 0.59 mol%, for mutant P32A 0.13 mol%, using substrate 1-stearoyl-2-oleoyl-sn-glycerol
additional information
additional information
Km value of wild-type, 2.35, mutant Y451, 2.07, mutant R457Q, 1.71 mol% 1-stearoyl-2-arachidonoyl-sn-glycerol, respectively, pH 7.2, 22C
Homo sapiens
wild-type protein with C-terminal His-tag, pH 7.2, 25C
Homo sapiens
wild-type protein, FLAG-tag, pH 7.2, 25C
Homo sapiens
N-terminally trucated protein, FLAG-tag, pH 7.2, 25C
Homo sapiens
wild-type protein with C-terminal His-tag, pH 7.2, 25C
Homo sapiens
wild-type protein, FLAG-tag, pH 7.2, 25C
Homo sapiens
N-terminally trucated protein, FLAG-tag, pH 7.2, 25C
Homo sapiens
wild-type protein with C-terminal His-tag, pH 7.2, 25C
Homo sapiens
wild-type protein, FLAG-tag, pH 7.2, 25C
Homo sapiens
N-terminally trucated protein, FLAG-tag, pH 7.2, 25C
Homo sapiens
mutant P32A
Homo sapiens
Homo sapiens
wild-type protein with C-terminal His-tag, pH 7.2, 25C
Homo sapiens
wild-type protein, FLAG-tag, pH 7.2, 25C
Homo sapiens
N-terminally trucated protein, FLAG-tag, pH 7.2, 25C
additional information
additional information
Dictyostelium discoideum
additional information
additional information
Homo sapiens
turnover numbers of full-length DGKepsilon with a C-terminal His tag, full-length FLAG-DGKepsilon and truncated FLAG-DGKepsilon
pH 7.5, 25C
pH 7.5, 25C
pH 7.5, 25C
pH 7.5, 25C
pH 7.5, 25C
pH 7.5, 25C
pH 7.5, 25C
pH 7.5, 25C
pH 7.5, 25C
pH 7.5, 25C
pH 7.5, 25C
pH 7.5, 25C
additional information
additional information
Ki-value for adenosine 5'-tetraphosphoryl-3-O-(1,2-dihexanoyl)-sn-glycerol is 0.036 mol%
additional information
additional information
Ki value in mol% for inhibitor 2,3-dioleoylglycerol is 1.7 for isoform alpha, 1.07 for isoform zeta, pH 7.2, 30C
recombinant MBP-fusion enzyme in recombinant insect cell extract, substrate 1-oleoyl-rac-glycerol
0.0002 - 0.018
substrate specificity and catalytic activity level of the isozymes at different liposome compositions
mutant enzyme D271A, specific activity is less than 0.0004 micromol/min/mg, in 50 mM HEPES, pH 7.4, 150 mM LiCl, 10 mM MgCl2, 5 mM ATP, and lipid vesicles; mutant enzyme D68A, specific activity is less than 0.0004 micromol/min/mg, in 50 mM HEPES, pH 7.4, 150 mM LiCl, 10 mM MgCl2, 5 mM ATP, and lipid vesicles; mutant enzyme E273A, specific activity is less than 0.0004 micromol/min/mg, in 50 mM HEPES, pH 7.4, 150 mM LiCl, 10 mM MgCl2, 5 mM ATP, and lipid vesicles
recombinant MBP-fusion enzyme in recombinant insect cell extract, substrate 1,3-dioleoyl-sn-glycerol
recombinant MBP-fusion enzyme in recombinant insect cell extract, substrate 1,2-dioleoyl-sn-glycerol
recombinant MBP-fusion enzyme in recombinant insect cell extract, substrate 1-stearoyl-2-arachidonoyl-sn-glycerol
mutant enzyme N96A, in 50 mM HEPES, pH 7.4, 150 mM LiCl, 10 mM MgCl2, 5 mM ATP, and lipid vesicles
mutant enzyme D124A, in 50 mM HEPES, pH 7.4, 150 mM LiCl, 10 mM MgCl2, 5 mM ATP, and lipid vesicles
mutant enzyme K15A/K165A, in 50 mM HEPES, pH 7.4, 150 mM LiCl, 10 mM MgCl2, 5 mM ATP, and lipid vesicles
mutant enzyme T94A, in 50 mM HEPES, pH 7.4, 150 mM LiCl, 10 mM MgCl2, 5 mM ATP, and lipid vesicles
mutant enzyme D97A, in 50 mM HEPES, pH 7.4, 150 mM LiCl, 10 mM MgCl2, 5 mM ATP, and lipid vesicles
mutant enzyme D216A, in 50 mM HEPES, pH 7.4, 150 mM LiCl, 10 mM MgCl2, 5 mM ATP, and lipid vesicles
mutant enzyme K15A, in 50 mM HEPES, pH 7.4, 150 mM LiCl, 10 mM MgCl2, 5 mM ATP, and lipid vesicles
mutant enzyme K165A, in 50 mM HEPES, pH 7.4, 150 mM LiCl, 10 mM MgCl2, 5 mM ATP, and lipid vesicles
mutant enzyme R100A, in 50 mM HEPES, pH 7.4, 150 mM LiCl, 10 mM MgCl2, 5 mM ATP, and lipid vesicles
wild type enzyme, in 50 mM HEPES, pH 7.4, 150 mM LiCl, 10 mM MgCl2, 5 mM ATP, and lipid vesicles
mutant enzyme R20A, in 50 mM HEPES, pH 7.4, 150 mM LiCl, 10 mM MgCl2, 5 mM ATP, and lipid vesicles
enzyme form DGK-II
enzyme form DGK-I
substrate 1,2-dioctanoyl-sn-glycerol, pH 7.0, 25C
enzyme form DGK IV
enzyme form DGK-III
purified solubilized MBP-fusion wild-type enzyme
1500000 Da enzyme
enzyne form DGK I
80000 Da enzyme
purified recombinant mutant W25L
purified recombinant mutant W18L/W25L/W47L
purified recombinant mutant W18L/W25L/W47L/W117L
purified recombinant mutant W18L/W25L
purified recombinant mutant W18L
purified recombinant mutant W18L/W47L/W117L
substrate 1,2-dioleoyl-sn-glycerol, pH 7.0, 25C
purified recombinant wild-type enzyme
additional information
the enzyme is assayed by using endogenous substrate
additional information
activity measurment of enzyme solubilized in liposomes consisting different amounts of 1,2-dioleoylphosphatidylcholine, 1,2-dioleoylphosphatidylethanolamine, and 1,2-dioleoylphosphatidylserine, overview
additional information
enzyme from supernantant fraction
6.3 - 8.3
enzyme from microtubule
assay at
and a second optimum at pH 8
broad around, enzyme in plasma membrane vesicles from shoots
phosphatidylcholine-dependent activity
7.5 - 8
assay at
and a second optimum at pH 7
broad, deoxycholate-dependent or phosphatidylcholine-dependent activity
4.5 - 7.5
pH 4.5: about 50% of maximal activity, pH 7.5: about 45% of maximal activity, enzyme from supernatant. pH 4.5: about 55% of maximal activity, pH 7.5: about 45% of maximal activity, enzyme from microtubuli
6 - 8.5
pH 6.0: about 40% of maximal activity, pH 8.5: about 50% of maximal activity
6 - 9
about 50% of maximal activity at pH 6.0 and 9.0
6.5 - 7
rapid decrease of activity below pH 6.5, pH 7: optimum
6.5 - 7.8
rapid decrease below pH 6.5 and above pH 7.8
6.5 - 8.5
pH 6.5: about 45% of maximal activity, pH 8.5: about 45% of maximal activity
6.5 - 9
pH 6.5: about 35% of maximal activity, pH 9.0: about 65% of maximal activity, phosphatidylcholine-dependent activity
6.8 - 9
pH 6.5: about 85% of maximal activity pH 9.0: about 50% of maximal activity, enzyme form DGK I
assay at
assay at
isoelectric focusing
additional information
it remains unclear whether the multiple species, observed by isoelectric focusing represent distinct isoforms of the enzyme, or are modified versions of the type I and type II enzyme
isozymes DGKalpha and DGKzeta
Manually annotated by BRENDA team
; microvessel
Manually annotated by BRENDA team
DGK-Ialpha; DGK-Vtheta, cerebellar cortex and hippocampus
Manually annotated by BRENDA team
DGK-IVksi; neuron, DGK-Ibeta; oligodendrocyte, DGK-Ialpha; Purkinje cells, DGK-Igamma
Manually annotated by BRENDA team
DGKksi mRNA is expressed at high level
Manually annotated by BRENDA team
the enzyme is highly expressed in hippocampus, caudate nucleus, occipital pole, cerebral cortex and cerebellum
Manually annotated by BRENDA team
post-natal, developing, neuron-specific isozymes DGKbeta and DGKgamma, and isozyme DGKalpha, isozymes alpha and gamma appear at birth and then decline, while isozyme beta appears about 14 days after birth and reaches a maximum at day 28, overview
Manually annotated by BRENDA team
and olfactory sensilla trichodea, main localization in male adult
Manually annotated by BRENDA team
high expression
Manually annotated by BRENDA team
; nuclear diacylglycerol kinase-zeta is a negative regulator of cell cycle progression in C2C12 mouse myoblasts
Manually annotated by BRENDA team
nuclear DGKzeta increases during myogenic differentiation of mouse C2C12 myoblasts
Manually annotated by BRENDA team
diacylglycerol kinase zeta and syntrophins, scaffold proteins of the dystrophin glycoprotein complex that bind directly to diacylglycerol kinase zeta, are spatially regulated during fusion of cultured cells. Both proteins accumulate with the GTPase Rac1 at sites where fine filopodia mediate the initial contact between myoblasts. Diacylglycerol kinase zeta codistributes with the Ca2+-dependent cell adhesion molecule N-cadherin at nascent cell contacts
Manually annotated by BRENDA team
treated with benzothiadiazole and infected by Xanthomonas oryza pv. oryza. Treatment activates expression of a diacylglycerol kinase gene, OsDAGK1, and a phosphoinositide-specific phospholipase C gene, OsPI-PLC1, and a defence-related EREBP transcriptional factor gene, OsBIERF3
Manually annotated by BRENDA team
DGKeta1 and DGKeta2
Manually annotated by BRENDA team
Manually annotated by BRENDA team
enzyme expression remained almost unchanged in granulocytic differentiation pathway; enzyme expression remains almost unchanged in granulocytic differentiation pathway
Manually annotated by BRENDA team
low activity
Manually annotated by BRENDA team
low expression
Manually annotated by BRENDA team
pyramidal cells, isozymes DGKbeta and DGKgamma
Manually annotated by BRENDA team
moderate labeling in the hippocampus
Manually annotated by BRENDA team
level of DGKgamma is rapidly and markedly decreased upon cellular differentiation into macrophages; levels of DGKgamma mRNA/protein is rapidly and markedly decreased upon cellular differentiation into macrophages
Manually annotated by BRENDA team
a subclone of embryo fibroblasts
Manually annotated by BRENDA team
; DGKalpha expression in T cells inhibits secretion of FasL-bearing exosomes triggered by receptor stimulation, and subsequent acivation-induced cell death is impaired. Conversely, the inhibition of DGKalpha enhances the secretion of these lethal exosomes carrying mFasL and enhances acivation-induced cell death
Manually annotated by BRENDA team
DGKzeta depletion in JURKAT cells accelerates transferrin receptor exit from the endocytic recycling compartment
Manually annotated by BRENDA team
DGKeta1 and DGKeta2
Manually annotated by BRENDA team
low expression
Manually annotated by BRENDA team
especially cauline
Manually annotated by BRENDA team
low activity
Manually annotated by BRENDA team
low expression
Manually annotated by BRENDA team
at different developmental stages, isozyme spatiotemporal expression pattern, changes during development, overview
Manually annotated by BRENDA team
high expression
Manually annotated by BRENDA team
alveolar, isozymes DGKalpha and DGKzeta
Manually annotated by BRENDA team
mammary carcinoma
Manually annotated by BRENDA team
breast cancer cell
Manually annotated by BRENDA team
mammary carcinoma
Manually annotated by BRENDA team
isozyme DGKgamma, day 3-14 after birth
Manually annotated by BRENDA team
DGKbeta is expressed in medium spiny neurons constituting the striatonigral and striatopallidal pathways, whereas striatal interneurons are below the detection threshold
Manually annotated by BRENDA team
; expression of isoform diacylglycerol kinase alpha in several melanoma cell lines but not in noncancerous melanocytes
Manually annotated by BRENDA team
diaclyglycerol kinase activity is reduced by oxidative stress in glomerular mesangial cells cultured under high glucose conditions. Antioxidants, including D-alpha-tocopherol and probucol may improve hyperglycemia-induced diacylglycerol-protein kinase C activation by enhancing diacylglycerol kinase activity
Manually annotated by BRENDA team
ventricular myocyte
Manually annotated by BRENDA team
expression of diacylglycerol kinase isoform alpha, delta, epsilon, zeta, or theta mRNA
Manually annotated by BRENDA team
activation of the adrenocorticotropin/cAMP signal transduction cascade rapidly increases nuclear diacylglycerol kinase activity and phosphatidic acid production. LXXLL motifs in diacylglycerol kinase theta mediate a direct interaction of nuclear receptor steroidogenic factor 1 with the kinase and may facilitate binding of phosphatidic acid to the receptor
Manually annotated by BRENDA team
weak labeling in the neocortex
Manually annotated by BRENDA team
of accumbens nucleus, caudate-putamen and olfactory tubercle, DGK-II
Manually annotated by BRENDA team
of the brain, DGK-Ibeta
Manually annotated by BRENDA team
neuron-specific isozymes DGKbeta and DGKgamma having a spatio-temporally different function in the neuron
Manually annotated by BRENDA team
dendritic spines on neuronal dendrites
Manually annotated by BRENDA team
weak labeling in the olfactory bulb
Manually annotated by BRENDA team
of the brain, DGK-Ialpha
Manually annotated by BRENDA team
DGKalpha is expressed predominantly in oligodendrocytes
Manually annotated by BRENDA team
DGKalpha is expressed predominantly in oligodendrocytes
Manually annotated by BRENDA team
selective increase in nuclear DGK-theta activity in response to nerve growth factor stimulation
Manually annotated by BRENDA team
DGKbeta is the major isozyme in the pituitary gland, the signals are also detected intensely for isoform DGKzeta, moderately for DGKepsilon and faintly for DGKalpha, the signals for isoforms DGKgamma and DGKiota are below the detection level
Manually annotated by BRENDA team
isoenzyme DGK-I, DGK-II and DGK-II
Manually annotated by BRENDA team
delay of isozyme DGKgamma
Manually annotated by BRENDA team
Manually annotated by BRENDA team
expression is induced by benzothiadiazole, and by infection with Magnaporthe grisea. In benzothiadiazole-treated rice seedlings, expression is induced earlier and at a higher level than in water-treated control seedlings after inoculation with Magnaporthe grisea
Manually annotated by BRENDA team
and brain, main localization in male adult
Manually annotated by BRENDA team
DGK-IIdelta; DGK-IVksi
Manually annotated by BRENDA team
short term exposure of skeletal muscle cells to glucose causes a rapid induction of DGK, followed by a reduction of protein kinase C-alpha activity and transactivation of the insulin receptor signaling
Manually annotated by BRENDA team
patients with type 2 diabetes mellitus display reduced diacylglycerol kinase delta expression and activity in skeletal muscle
Manually annotated by BRENDA team
DGKiota immunoreactivity is distributed solely in the cytoplasm of most of the dorsal root ganglion; DGKzeta is detected heterogeneously in the nucleus and cytoplasm of small neurons of the dorsal root ganglion with variable levels of distribution, whereas it is detected exclusively in the cytoplasm of large neurons
Manually annotated by BRENDA team
high expression
Manually annotated by BRENDA team
DGKbeta is strongly detected in the striatum, DGKbeta is expressed not only in projection neurons but also in interneurons and is concentrated at perisynaptic sites of asymmetrical synapses
Manually annotated by BRENDA team
diacylglycerol kinase beta accumulates on the perisynaptic site of medium spiny neurons in the striatum
Manually annotated by BRENDA team
particularly enriched in peripheral T lymphocytes
Manually annotated by BRENDA team
particularly enriched in peripheral T lymphocytes
Manually annotated by BRENDA team
DGK-IIdelta and DGK-IIIepsilon
Manually annotated by BRENDA team
DGKeta1 and DGKeta2
Manually annotated by BRENDA team
high expression
Manually annotated by BRENDA team
Manually annotated by BRENDA team
particularly enriched in thymus
Manually annotated by BRENDA team
particularly enriched in thymus
Manually annotated by BRENDA team
levels of DGKgamma mRNA/protein is rapidly and markedly decreased upon cellular differentiation into macrophages
Manually annotated by BRENDA team
level of DGKgamma is rapidly and markedly decreased upon cellular differentiation into macrophages
Manually annotated by BRENDA team
DGKzeta-immunoreactivity is clearly detected in Iba1-immunoreactive cells of an oval or ameboid shape in the scar region, which represent activated microglia and/or macrophages. DGKzeta-immunoreactivity is not detected in Iba1-immunoreactive, resting microglia of ramified and dendritic configuration in the intact cortex
Manually annotated by BRENDA team
additional information
DGKeta1 is ubiquitously distributed in various tissues, DGKeta2 is detected only in testis, kidney and colon
Manually annotated by BRENDA team
additional information
expression profile of isozymes during development
Manually annotated by BRENDA team
additional information
tissue-specific expression of isozymes
Manually annotated by BRENDA team
additional information
isozyme DGK2 expression in various tissues, expression pattern
Manually annotated by BRENDA team
additional information
expression is first detected at day 3 of the pupal stage, then reaches a maximum at the end of the pupal stage, and is maintained at this level during the adult period
Manually annotated by BRENDA team
GeneOntology No.
DGKepsilon is detected in a filamentous pattern, parallel to the long axis of cell, and on actin stress fibers
Manually annotated by BRENDA team
prior to cell attachment, phorbol ester induce translocation of DGKgamma from the cytoplasm to the cell periphery
Manually annotated by BRENDA team
one variant of DGKbeta is associated with the plasma membrane, the other isoform is predominantly localized within the cytoplasm
Manually annotated by BRENDA team
DGKeta1 and DGKeta2 are rapidly translocated from the cytoplasm to endosomes in response to stress stimuli. DGKeta1 is rapidly relocated back to the cytoplasm upon removal of stress stimuli. DGKeta2 exhibits sustained endosomal association
Manually annotated by BRENDA team
DGKiota immunoreactivity is distributed solely in the cytoplasm of most of the dorsal root ganglion
Manually annotated by BRENDA team
cytoplasm at the early stage of culture, indicating that DGKgamma is transported from the cytoplasm to the nucleus
Manually annotated by BRENDA team
; co-localizes with actin filaments
Manually annotated by BRENDA team
in the basal state, DGKzeta resides in the cytoplasm, but upon appropriate cellular events, it translocates to different parts of the cell in order to perform its biological role
Manually annotated by BRENDA team
DGK-zeta export from nucleus to cytoplasm is regulated by a leucine-rich nuclear export signal through the exportin chromosome regional maintenance protein 1
Manually annotated by BRENDA team
isoform DGKalpha is detected sparsely in the cytoplasm, in aortic smooth muscle cell contracted by serotonin DGKepsilon is detected diffusely in the cytoplasm without a filamentous stress fiber pattern
Manually annotated by BRENDA team
localized in the narrow cytoplasmic space between smooth endoplasmic reticulum and plasma membrane
Manually annotated by BRENDA team
isoform diacylglycerol kinase delta-1, but not a splice variant isoform diacylglycerol kinase delta-2 or the other type II isoform diacylglycerol kinase ny-1/2, translocates from the cytoplasm to the plasma membrane in HEK-293 and mouse myoblast C2C12 cells within 5 min in response to high glucose levels. The translocation is inhibited by phosphatidylinositol 3-kinase inhibitors, LY294002 and GDC-0941. The PH and C1 domains are responsible for the plasma membrane translocation and the sterile alpha-motif domain negatively regulates the translocation
Manually annotated by BRENDA team
no activity in cytosol
Manually annotated by BRENDA team
isoenzyme DGK-I, DGK-II and DGK-II
Manually annotated by BRENDA team
in lymphocytes the basal activity is 1.6fold higher in the membrane fraction than in cytosol. In neutrophils the basal activity is identical in cytosol and mambrane-fraction
Manually annotated by BRENDA team
isozyme DGKgamma in hippocampal pyriamidal cells and proximal dendrites
Manually annotated by BRENDA team
DGKalpha is a cytosolic enzyme that must relocate to the membrane in response to receptor stimulation to exercise its function
Manually annotated by BRENDA team
DGKalpha is a cytosolic enzyme that must relocate to the membrane in response to receptor stimulation to exercise its function
Manually annotated by BRENDA team
fusion constructs of Green Fluorescent Protein to truncated forms of diacylglycerol kinase 1 and diacylglycerol kinase 2 missing the catalytic and accessory domains
Manually annotated by BRENDA team
DGKeta1 and DGKeta2 are rapidly translocated from the cytoplasm to endosomes in response to stress stimuli. DGKeta1 is rapidly relocated back to the cytoplasm upon removal of stress stimuli. DGKeta2 exhibits sustained endosomal association. Oligomerization of DGKeta2 mediated by its SAM domain is largely responsible for its sustained endosomal localization
Manually annotated by BRENDA team
prior to cell attachment, phorbol ester induce translocation of DGKgamma from the cytoplasm to the cell periphery
Manually annotated by BRENDA team
trans-Golgi network
Manually annotated by BRENDA team
diacylglacerol kinase isoform gamma
Manually annotated by BRENDA team
tightly associated with the inner membrane
Manually annotated by BRENDA team
intrinsic membrane-protein
Manually annotated by BRENDA team
bound to; DGK IV
Manually annotated by BRENDA team
integral membrane protein
Manually annotated by BRENDA team
in lymphocytes the basal activity is 1.6fold higher in the membrane fraction than in cytosol. In neutrophils the basal activity is identical in cytosol and membrane-fraction
Manually annotated by BRENDA team
integral membrane protein
Manually annotated by BRENDA team
the hydrophobic domain of DGKepsilo does not contribute to substrate specificity but plays a role in permanently sequestering the enzyme to a membrane
Manually annotated by BRENDA team
the region of transmembrane helix 1 spanning the hydrophobic core of the bilayer runs from Glu28 on the cytoplasmic side to Asp49 or Val50 on the periplasmic side. This locates the charged/polar cluster 32RQE34 within the hydrophobic core of the bilayer. Hydrophobic matching between the protein and the surrounding lipid bilayer is highly efficient
Manually annotated by BRENDA team
mainly associated with internal membranes
Manually annotated by BRENDA team
upon activation of T lymphocytes, diacylglycerol kinase alpha is phosphorylated, and the phosphoprotein is located at the plasma membrane
Manually annotated by BRENDA team
segment from amino acid residues 18 to 42 forms a bent helix that enters and leaves the same side of the membrane
Manually annotated by BRENDA team
recruitment of diacylglycerol kinase alpha to the membrane is mediated both via its proline-rich sequence and phosphorylation of Y335
Manually annotated by BRENDA team
sterile alpha-motif of diacylglycerol kinase delta1 forms helical polymers through a head-to-tail interaction. Disruption of polymerization by mutations constitutively localizes the enzyme to the plasma membrane
Manually annotated by BRENDA team
DGKalpha is a cytosolic enzyme that must relocate to the membrane in response to receptor stimulation to exercise its function
Manually annotated by BRENDA team
DGKalpha is a cytosolic enzyme that must relocate to the membrane in response to receptor stimulation to exercise its function
Manually annotated by BRENDA team
at early stages of T cell immunological synapse formation, isoform zeta translocates rapidly to the plasma membrane
Manually annotated by BRENDA team
DGK-theta is localized in the speckle domain of the nucleus
Manually annotated by BRENDA team
agonist-induced activity of nuclear DGKthata activity, nuclear localization of DGKdelta
Manually annotated by BRENDA team
DGKzeta is detected heterogeneously in the nucleus and cytoplasm of small neurons of the dorsal root ganglion with variable levels of distribution, whereas it is detected exclusively in the cytoplasm of large neurons
Manually annotated by BRENDA team
; involvement of isoform diacylglycerol kinase zeta in cell-cycle progression
Manually annotated by BRENDA team
isoform diacylglycerol kinase zeta localizes to the nucleus during interphase including G1, S, and G2 phases in NIH-3T3 cells and in proliferating spermatogonia in the testis. Enzyme is associated with chromatin and dissociates from chromatin during mitotic phase
Manually annotated by BRENDA team
DGK-zeta displays a functional independent nuclear export signal sequence between the amino acid residues 362-370
Manually annotated by BRENDA team
isoform DGKzeta is observed as a granular pattern in the nucleus, isoform DGKalpha is detected sparsely in the nucleus
Manually annotated by BRENDA team
a portion of intracellular DGKzeta protein is localized to the nucleus
Manually annotated by BRENDA team
activity of DGK-I is recovered dominantly in the soluble fraction, that for DGK-II in the particulate fraction and that for DGK-III in soluble and particulate fraction
Manually annotated by BRENDA team
active site of the enzyme is localized to the inner cytoplasmic surface
Manually annotated by BRENDA team
one variant of DGKbeta is associated with the plasma membrane, the other isoform is predominantly localized within the cytoplasm
Manually annotated by BRENDA team
activation and relocalization to plasma membrane of DGKalpha is a direct consequence of PI3K activation
Manually annotated by BRENDA team
isozyme DGKbeta predominantly, in hippocampal pyriamidal neurons including perikarya and the peripheral dendrites, dendrit cell body
Manually annotated by BRENDA team
isoform diacylglycerol kinase delta-1, but not a splice variant isoform diacylglycerol kinase delta-2 or the other type II isoform diacylglycerol kinase ny-1/2, translocates from the cytoplasm to the plasma membrane in HEK-293 and mouse myoblast C2C12 cells within 5 min in response to high glucose levels. The translocation is inhibited by phosphatidylinositol 3-kinase inhibitors, LY294002 and GDC-0941. The PH and C1 domains are responsible for the plasma membrane translocation and the sterile alpha-motif domain negatively regulates the translocation
Manually annotated by BRENDA team
activity of DGK-I is recovered dominantly in the soluble fraction, that for DGK-II in the particulate fraction and that for DGK-III in soluble and particulate fraction
Manually annotated by BRENDA team
additional information
subcellular localization of isozymes, overview, the enzyme must undergo membrane translocation for access of diacylglycerols
Manually annotated by BRENDA team
additional information
no isozyme DGKgamma in the nucleus, subcellular localization of isozymes in neurons
Manually annotated by BRENDA team
additional information
diacylglacerol kinase isoform epsilon is distributed around the perinuclear region
Manually annotated by BRENDA team
Escherichia coli (strain K12)
Escherichia coli (strain K12)
Escherichia coli (strain K12)
Escherichia coli (strain K12)
Escherichia coli (strain K12)
Escherichia coli (strain K12)
Escherichia coli (strain K12)
Escherichia coli (strain K12)
Escherichia coli (strain K12)
Escherichia coli (strain K12)
Escherichia coli (strain K12)
Escherichia coli (strain K12)
Escherichia coli (strain K12)
Escherichia coli (strain K12)
Escherichia coli (strain K12)
Staphylococcus aureus (strain MRSA252)
Staphylococcus aureus (strain MRSA252)
gel filtration
isoform DGKepsilon
less than, sucrose density gradient centrifugation
microtubular enzyme, sucrose density gradient centrifugation
enzyme form DGK-II, gel filtration
gel filtration
gel filtration
isoform DGKbeta, SDS-PAGE
702913, 703560
gel filtration
isoform DGK-zeta, SDS-PAGE
gel filtration
additional information
the molecular weight of the peak fraction of enzyme from supernatant is 125000 Da and the average molecular weight is 160000 Da, suggesting that more than one species might be present
x * 14000 Da, SDS-PAGE
x * 152000, enzyme form DGK-I, SDS-PAGE; x * 58000, enzyme form DGK-III, SDS-PAGE
x * 13245, calculation from nucleotide sequence; x * 14300, SDS-PAGE
x * 108000, enzyme from Hela cells, SDS-PAGE; x * 110000, enzyme from cell lines MDA-MB-453 and MCF-7, SDS-PAGE
1 * 110000, enzyme from cell line PC12, SDS-PAGE
x * 101400, DGK-Vtheta, calculation from amino acid sequence; x * 104000, DGK-IVksi, calculation from amino acid sequence; x * 130000, DGK-IIdelta, calculation from amino acid sequence; x *63900, DGK-IIIepsilon, calculation from amino acid sequence; x * 82700, DGK-Ialpha, calculation from amino acid sequence; x * 89000, DGK-Igamma, calculation from amino acid sequence
x * 126800, DGK-IIeta, calculation from amino acid sequence
x * 104000, DGK-IVksi, calculation from amino acid sequence; x * 82200, DGK-Ialpha, calculation from amino acid sequence; x * 88500, DGK-Igamma, calculation from amino acid sequence; x * 90300, DGK-Ibeta, calculation from amino acid sequence
x * 82600, DGK-Ialpha, calculation from amino acid sequence
x * 103900, calculation from nucleotide sequence
x * 128000 DGKeta1, calculation from nucleotide sequence; x * 135000, DGKeta2, calculation from nucleotide sequence
x * 79400, about, sequence calculation, x * 140000, about, recombinant NusA/His6-tagged isozyme DGK2, SDS-PAGE
x * 88000-90000, isozymes DGKalpha, DGKbeta, and DGKgamma, SDS-PAGE
x * 34000, calculated and SDS-PAGE
x * 109500, calculated
x * 37333, calculated, x * 42000, SDS-PAGE
solution nuclear magnetic resonance method
1 * 51000, SDS-PAGE
1 * 86000, SDS-PAGE
1 * 15000, SDS-PAGE
1 * 78000, SDS-PAGE
GKepsilon is monomeric on SDS-PAGE but exhibits partial dimerization with low concentrations of perfluorooctanoic acid
additional information
isozyme theta is the only one of 9 isozyme forms, that possesses three instead of two cysteine-rich domains at the N-terminal regulatory region
additional information
structure-function relationships of isozyme domain motifs, overview
additional information
structure-function relationships of isozyme domain motifs, e.g. the C1 domain, the EF hand, and the pleckstrin homology, structural motifs and their organization, mammalian isozymes require other domain in addition to the catalytic domain for activity, overview
additional information
structural organization of isozymes containing a 1,2-diacylglycerol/phorbolester-binding domain 1, a zinc-finger dependent C1 domain, and a 1,2-diacylglycerol accessory domain, overview
additional information
wild-type protein has a weak tendency to oligomerize in presence of weak detergents
additional information
association of diacylglycerol kinase zeta with sorting nexin 27 via postsynaptic density protein-domain. The sorting nexin 27 postsynaptic density protein-domain contributes to its vesicle localization, interaction with diacylglycerol kinase zeta may regulate localization
additional information
diacylglycerol kinase delta2 interacts with the platform subdomain of adaptor protein AP2alpha through its DXF-type binding motif. Binding is involved in the transferrin internalization
additional information
the N-terminal half of the catalytic region of diacylglycerol kinase gamma interacts with the Src homology 2 and C1 domains of beta-chimaerin. The Src homology 2 domain contributes to the interaction independently of phosphotyrosine
additional information
diacylglycerol kinase zeta is associated with chromatin and dissociates from chromatin during mitotic phase
additional information
nuclear receptor steroidogenic factor 1 binds to diacylglycerol kinase zeta and diacylglycerol kinase theta in vitro and in vivo
additional information
interaction with SH3 and SH2 domains of Src are mediated both via its proline-rich sequence and phosphorylation of Y335
additional information
sterile alpha-motif of diacylglycerol kinase delta1 forms helical polymers through a head-to-tail interaction. Disruption of polymerization by mutations constitutively localizes the enzyme to the plasma membrane
both hepatocytes growth factor stimulation and v-Src transformation induce tyrosine phosphorylation of diacylglycerol kinase alpha on Y335, through a mechanism requiring its proline-rich C-terminal sequence. Both proline-rich sequence and phosphorylation of Y335 mediate its enzymatic activation, its ability to interact respectively with SH3 and SH2 domains of Src, its recruitment to the membrane. Phosphorylation is required for hepatocyte growth factor-induced motility
upon stimulation of T lymphocytes, diacylglycerol kinase alpha is phosphorylated at residue Y335 by Src kinase p56lck. Phosphorylation regulates translocation of enzyme to cell membrane
the 80000 Da enzyme form is phosphorylated by an unidentified protein kinase
sitting-drop vapour-diffusion method. Crystals belong to space group P2(1), with unit-cell parameters a = 42.4, b = 166.1, c = 48.5 A, beta = 96.97
isoform DgkB, both as free enzyme and in complex with ADP, 2.4 and 2.3 A resolution, respectively. Enzyme is a tight homodimer, and each monomer comprises two domains with the catalytic center located within the interdomain cleft
5 min, complete loss of activity of DGK-II and DGK-III, about 10% loss of activity of enzyme form DGK-I
43 - 45
preincubation of microtubules, 10 min, 50% loss of activity
Triton-solubilized preparation, t1/2: 12 min
enzyme activity of membranes, t1/2: 20 min
the membrane preparation shows a threefold stimulation by heating for 5 min followed by a gradual loss of activity, half-life: about 1 h. Butane-1-ol-dissolved enzyme has a half-life of about 45 min
additional information
addition of phospholipids provides some protection from thermal inactivation
enzyme is unstable in membrane extract, upon storage overnight at 4C 90% of the activity is lost
lipid activators stabilize the enzyme agisnt inactivation induced by diacylglycerol. Mg2+ and Mn2+ show only a small stabilization effect both in presence and in absence of 10 mol% phosphatidylglycerol
when cosolubilized with diacylglycerol in octylglucoside micelles, the enzyme undergoes rapid irreversible inactivation
enzyme activity is destroyed by trypsin, no protection by substrate
activation of tyrosine kinases is required for membrane stabilization of DGKalpha, phosphorylation of DGKalpha at Tyr335 appears to be essential for membrane localization
activation of tyrosine kinases is required for membrane stabilization of DGKalpha, phosphorylation of DGKalpha at Tyr335 appears to be essential for membrane localization
DGKalpha is also activated when it binds to membranes
microsomal activity is more unstable on storage at 0C than the soluble enzyme
4C, -20C or -70C, more than 50% of the activity is lost after overnight storage in presence of 10 or 20% glycerol
-20C, in presence of 1 mM dithiothreitol, microsomal and soluble enzyme stable for about 1 week
4C, enzyme concentrated by polyethyleneglycol 6000, stable for 1 week
4C, purified enzyme, 50% loss of activity after 3 days
the 150000 Da enzyme is very unstable but can be stored at -80C in presence of bovine serum albumin
CHAPS is the most effective detergent for isozyme DGK2 solubilization, NusA/His6-tagged fusion isozyme DGK2 from Escherichia coli strain BL21(DE3) by nickel affinity chromatography
recombinant protein
recombinant N-terminally His-tagged wild-type and mutant enzymes or MBP-fusion protein from insect cells by nickel affinity chromatography
native enzyme, by ultracentrifugation, gel filtration, and antibody affinity chromatography
recombinant HIs-tagged wild-type and mutant enzymes
isoenzyme DGK-I and DGK-II, DGK-II only partially purified
truncated protein lacking the 40 N-terminal amino acids may be extracted with 1.5 M KCl at neutral pH value, while wild-type protein remains fully membrane bound
recombinant GST-fusion isozymes DGKalpha, DGKgamma, and DGKbeta from Escherichia coli, and Sf9 cells, respectively, and from COS-7 cells, by glutathione affinity chromatography
Ni-NTA column chromatography
a heat-labile 80000 Da enzyme and a heat-stable 150000 Da enzyme
partially, recombinant wild-type and point mutant enzymes from yeast by ion exchange chromatography
AtDGK2, DNA and amino acid sequence determination and analysis, phylogenetic analysis, expression as NusA/His6-tagged isozyme DGK2 in Escherichia coli strain BL21(DE3)
expression in Arabidopsis thaliana protoplasts
expression as His-tagged protein, Escherichia coli; expression in Escherichia coli
gene dgk-1alpha, DNA and amino acid sequence determination and analysis of wild-type and mutant enzymes, expression of N-terminally His-tagged wild-type and mutant enzymes and of wild-type enzyme enzyme fused to the maltose binding protein in insect cells via the baculovirus infection system, enzyme is found to 95% in aggregated form
expression in COS-7 and HEK-293T cells
a 100fold overproduction is obtained when dgkA is placed on a hybrid plasmid under control of the lambdapl promoter
expression of His-tagged wild-type and mutant enzymes
cDNA subcloned into the EcoRI site of the simian virus 40-based expression vector pSRE
COS-7 cells transfected with DGKksi cDNA express a 117000 Da and a 114000 Da protein. The transfected cells also express increased diacylglycerol kinase activity, which is not altered in the presence of R59949
COS-7 transfection
expressed in COS-7 cells and in baculovirus-infected Sf21 insect cells
expressed in HEK-293, U2OS, MCF-7, Swiss3-T3, MEF, and Phoenix cells
expression in COS-7 cell
expression in COS-7 cell and HeLa cell
expression in COS-7 cell, with FLAG-tag
expression in COS-7 cells
expression in COS-7 cells; expression of truncated enzyme forms in COS-7 cells
expression in IIC9 cells
expression in lymphocyte
expression in SF21 cells
expression of GFP-tagged or FLAG-tagged wild-type and mutant isozymes theta in COS-7 cells
expression of the isolated catalytic subunit of isozyme alpha shows 60% of maximal wild-type full length enzyme activity
subcloning into the expression vector pMT-2 and transfection in COS-7 cells results in a 6-7fold increase in diacylglycerol kinase activity
the DGKbeta gene can generate several enzyme isoforms which can display different expression levels and subcellular localization but similar enzymatic activities in vitro
transfection of HEK-293 cells, COS-7 cells
insect cells infected with recombinant baculovirus containing the cDNA
expression in T lymphocyte and COS-7 cells
expression in Escherichia coli
expression in tobacco
cDNA subcloned into the EcoRI site of the simian virus 40-based expression vector pSRE
expression in COS-7 cell; expression in COS-7 cell; expression in COS-7 cell; expression in COS-7 cell
expression in NIH 3T3 cells
GFP-tagged DGKh and DGKg co-expressed in human neuroblastoma cells SH-SY5Y, expression of GST-fusion isozyme DGKalpha and DGKgamma in Escherichia coli strain DH5alpha, expression of GST-fusion isozyme DGKbeta in Spodoptera frugiperda Sf9 cells via baculovirus infection system, expression of GST-fusion isozymes DGKalpha, DGKbeta, and DGKgamma in COS-7 cells
high kinase activity is shown in COS cells transfected with either one of the three cDNAs for DGK-I, DGK-II or DGK-III
expressed in Escherichia coli BL21(DE3) cells
cDNA subcloned into the EcoRI site of the simian virus 40-based expression vector pSRE
expression of wild-type and deletion mutant enzymes in COS-1 cells, expression of wild-type and point mutant enzymes in the enzyme-deficient Saccharomyces cerevisiae strain WY294
p53-mediated upregulation of DGKalpha mRNA in human-derived cells, (PPAR)-gamma-dependent DGKalpha upregulation in endothelial cells, DMSO-based differentiation of promyelocytic HL-60 cells into a neutrophilic phenotype correlates with increase in the expression of DGKalpha, DGKalpha expression is upregulated in cancer
p53-mediated upregulation of DGKalpha mRNA in mouse-derived cells, (PPAR)-gamma-dependent DGKalpha upregulation in endothelial cells, DMSO-based differentiation of promyelocytic HL-60 cells into a neutrophilic phenotype correlates with increase in the expression of DGKalpha, DGKalpha expression is upregulated in cancer
DGKzeta mRNA levels are increased in mice on a high-fat diet, but are lower in those that become obese by a high-fat diet
as early as 1h after cryoinjury, DGKzeta-immunoreactivity is greatly decreased in the afflicted cerebral cortex and almost disappears in the necrotic core. On day 7 after cryoinjury, however, DGKzeta-immunoreactivity reappears in this area
protein and mRNA expression of isoform DGKepsilon in aortic smooth muscle cells is significantly increased by stimulation with serotonin
DGKzeta mRNA levels are increased in rats on a high-fat diet, but are lower in those that become obese by a high-fat diet
DGKzeta is induced in activated microglia in brain trauma
mutant isolated due to defects in DGK-1 controlled behaviour, altered behaviour compared to the wild-type enzyme, overview
mutant isolated due to defects in DGK-1 controlled behaviour, altered behaviour compared to the wild-type enzyme, overview
mutant isolated due to defects in DGK-1 controlled behaviour, altered behaviour compared to the wild-type enzyme, overview
mutant isolated due to defects in DGK-1 controlled behaviour, altered behaviour compared to the wild-type enzyme, overview
mutant isolated due to defects in DGK-1 controlled behaviour, altered behaviour compared to the wild-type enzyme, overview
mutant isolated due to defects in DGK-1 controlled behaviour, altered behaviour compared to the wild-type enzyme, overview
mutant isolated due to defects in DGK-1 controlled behaviour, altered behaviour compared to the wild-type enzyme, overview
mutant isolated due to defects in DGK-1 controlled behaviour, altered behaviour compared to the wild-type enzyme, overview
mutant isolated due to defects in DGK-1 controlled behaviour, altered behaviour compared to the wild-type enzyme, overview
mutant isolated due to defects in DGK-1 controlled behaviour, altered behaviour compared to the wild-type enzyme, overview
mutant isolated due to defects in DGK-1 controlled behaviour, altered behaviour compared to the wild-type enzyme, overview
mutant isolated due to defects in DGK-1 controlled behaviour, altered behaviour compared to the wild-type enzyme, overview
mutant isolated due to defects in DGK-1 controlled behaviour, altered behaviour compared to the wild-type enzyme, overview
mutant isolated due to defects in DGK-1 controlled behaviour, altered behaviour compared to the wild-type enzyme, overview
mutant isolated due to defects in DGK-1 controlled behaviour, altered behaviour compared to the wild-type enzyme, overview
significantly impaired catalytic function, without evidence of gross structural alterations, subunit mixing experiments of mutant enzymes, subunit mixing experiments of mutant enzymes
mutant lacking all Cys residues. Activity is slightly higher than wild-type
introduction of Cys residue at transmembrane helix 1 into mutant lacking the native Cys residues. Low activity mutant, 64% trimer formation compared to wild-type
introduction of Cys residue at transmembrane helix 1 into mutant lacking the native Cys residues. Low activity mutant, 79% trimer formation compared to wild-type
introduction of Cys residue at transmembrane helix 1 into mutant lacking the native Cys residues. Low activity mutant, 93% trimer formation compared to wild-type
introduction of Cys residue at transmembrane helix 1 into mutant lacking the native Cys residues. Low activity mutant, 77% trimer formation compared to wild-type
introduction of Cys residue at transmembrane helix 1 into mutant lacking the native Cys residues. Low activity mutant, 63% trimer formation compared to wild-type
introduction of Cys residue at transmembrane helix 1 into mutant lacking the native Cys residues. Low activity mutant, 100% trimer formation compared to wild-type
introduction of Cys residue at transmembrane helix 1 into mutant lacking the native Cys residues. Low activity mutant, 72% trimer formation compared to wild-type
significantly impaired catalytic function, without evidence of gross structural alterations. Km-value for MgATP2- raises 18fold, subunit mixing experiments of mutant enzymes
mutant enzyme has an altered structure even in SDS
significantly impaired catalytic function, without evidence of gross structural alterations, subunit mixing experiments of mutant enzymes
mutant enzyme can not be purified because its expression is toxic to the Escherichia coli host
mutant enzyme can not be purified because its expression is toxic to the Escherichia coli host
mutant is highly misfolding while at the same time being more stable than the wild-type protein
mutant exhibits enhanced stability but folds with an efficiency similar to that of the wild type
significantly impaired catalytic function, without evidence of gross structural alterations. Km-value for MgATP2- raises 13fold, subunit mixing experiments of mutant enzymes
significantly impaired catalytic function, without evidence of gross structural alterations, subunit mixing experiments of mutant enzymes
site-directed mutagenesis, inactive mutant
site-directed mutagenesis, inactive mutant
site-directed mutagenesis, reduced activity compared to the wild-type enzyme
site-directed mutagenesis, reduced activity compared to the wild-type enzyme
site-directed mutagenesis, inactive mutant
site-directed mutagenesis, reduced activity compared to the wild-type enzyme
site-directed mutagenesis, inactive mutant
site-directed mutagenesis, reduced activity compared to the wild-type enzyme
site-directed mutagenesis, inactive mutant
site-directed mutagenesis, reduced activity compared to the wild-type enzyme
site-directed mutagenesis, reduced activity compared to the wild-type enzyme
site-directed mutagenesis, inactive mutant
mutant shows diminished Zn occupancy
mutant shows diminished Zn occupancy
mutant exhibits greatly reduced polymerization. Samples of the mutant incubated with an excess of zinc are shifted entirely to the insoluble fraction. In absence of zinc, most of the mutant protein sample is monomeric. In the presence of added zinc, the mutant organizes into large sheet structures
significant decrease in diacylglycerol kinase activity. Mutant cells display reduced uptake of transferrin
significant decrease in diacylglycerol kinase activity. Mutant cells display reduced uptake of transferrin
diacylglycerol kinase activity similar to that of wild-type. Mutant cells display reduced uptake of transferrin
site-directed mutagenesis, highly reduced activity compared to the wild-type isozyme theta
activity of the mutant is less than 1% of the wild type enzyme
mutant shows diminished Zn occupancy
mutant shows diminished Zn occupancy
mutant shows diminished Zn occupancy
mutant shows a reduced zinc retention of 3%. Construct does not show any increase in turbidity after incubation with 50 microM zinc acetate. In the absence of zinc, short polymers are observed, much like the wild-type protein. When zinc is added, polymers increase in prevalence and length marginally but no large sheet structures are formed in 50 microM zinc. Mutant diminishes the formation of cytoplasmic puncta, shows partially impaired regulation of transport to the plasma membrane, and lacks the ability to inhibit the formation of CopII coated vesicles
site-directed mutagenesis, slightly reduced activity compared to the wild-type isozyme theta
residue is required for the cholesterol recognition/interaction amino acid consensus motif, mutation results in a loss of enzymatic activity
site-directed mutagenesis, reduced activity compared to the wild-type isozyme theta
site-directed mutagenesis, reduced activity compared to the wild-type isozyme theta
site-directed mutagenesis, highly reduced activity compared to the wild-type isozyme theta
redcution of both Km and kcat value, while maintianing the ratio kcat/Km constant. Specificity of mutant for substrates with polyunsaturated acyl chains is retained. Mutant has a higher affinity for membranes
ratio of enzymic activity with substrates 1-stearoyl-2-linoleoyl-sn-glycerol to 1-stearoyl-2-arachidonoyl-sn-glycerol is 0.217
mutation results in the loss of the cholesterol recognition/interaction amino acid consensus motif and the loss of a positively charged residue, resulting in a higher enzymatic activity than wild-type. Ratio of enzymic activity with substrates 1-stearoyl-2-linoleoyl-sn-glycerol to 1-stearoyl-2-arachidonoyl-sn-glycerol is 0.099. Mutant gains preference for substrate 1-stearoyl-2-docosahexaenoyl-sn-glycerol
site-directed mutagenesis, activity is unaltered compared to the wild-type isozyme theta
mutation in diacylglycerol kinase zeta for mimicking of protein kinase C phosphorylation of serine residues within the MARCKS phosphorylation site domain. Mutations do prevent binding to retinoblastoma protein
mutation in diacylglycerol kinase zeta for mimicking of protein kinase C phosphorylation of serine residues within the MARCKS phosphorylation site domain. Mutations do not prevent binding to retinoblastoma protein and subsequent stimulation of activity
mutant exhibits greatly reduced polymerization, no polymers are visible in zinc-free conditions. After zinc addition, large sheet structures appear
expression of wild-type diacylglycerol kinase alpha markedly reduces ERK phosphorylation, whereas the effect of expressing the nonphosphorylatableY335F mutant is much less pronounced
mutation in sterile alpha-motif, mutant forms an oligomer
mutation in sterile alpha-motif, mutant is largely monomeric in solution
mutation in sterile alpha-motif, mutant is largely monomeric in solution
mutation in sterile alpha-motif, mutant is largely monomeric in solution
mutation in sterile alpha-motif, mutant forms an oligomer
mutant with reduced activity, used for construcution of fusion protein for genetic selection of soluble mutants
inactive mutant of diacylglycerol kinase epsilon due to replacement of ATP-binding domain GxGxxG with GxDxxG. Similar subcellular localization as wild type
inactive mutant of diacylglycerol kinase zeta due to replacement of ATP-binding domain GxGxxG with GxDxxG. Similar subcellular localization as wild type
inactive mutant of diacylglycerol kinase alpha due to replacement of ATP-binding domain GxGxxG with GxDxxG. Similar subcellular localization as wild type
inactive mutant of diacylglycerol kinase gamma due to replacement of ATP-binding domain GxGxxG with GxDxxG. Similar subcellular localization as wild type
residue involved in the Mg1-water network, no catalytic acitivity
mutant shows strongly reduced activity
mutant shows strongly reduced activity
residue involved in the Mg1-water network, no catalytic acitivity
mutant shows almost no activity
no catalytic activity. Role of D68 in mediating the interaction of Mg2+ with the gamma-phosphate of ATP
mutant shows almost no activity
mutant shows strongly reduced activity
no catalytic activity
mutant shows almost no activity
mutant shows reduced activity
mutant shows strongly reduced activity
mutant shows reduced activity
mutant shows strongly reduced activity
mutant shows reduced activity
mutant shows wild type activity
mutant shows strongly reduced activity
site-directed mutagenesis, inactive mutant
site-directed mutagenesis, inactive mutant
site-directed mutagenesis, inactive mutant
site-directed mutagenesis, 0.1% of wild-type activity
site-directed mutagenesis, inactive mutant
site-directed mutagenesis, 0.9% of wild-type activity, reduced stimulation by Ca2+ and phosphatidylserine compared to the wild-type enzyme
site-directed mutagenesis, 1.1% of wild-type activity
site-directed mutagenesis, 5.5% of wild-type activity, unaltered stimulation by Ca2+ and phosphatidylserine compared to the wild-type enzyme
site-directed mutagenesis, inactive mutant
site-directed mutagenesis, inactive mutant
site-directed mutagenesis, 1.4% of wild-type activity
additional information
expression of fusion constructs of Green Fluorescent Protein to truncated forms of diacylglycerol kinase 1 and diacylglycerol kinase 2 missing the catalytic and accessory domains. Fusion proteins are localized to the endoplasmic reticulum. Fusion constructs of N-terminal 50 amino acid residues of diacylglycerol kinase 1 and the 43 residues of diacylglycerol kinase 2 to the Yellow Fluorescent Protein alos localize to the endoplasmic reticulum
additional information
functional complementation of Escherichia coli dgkA mutant. Conditional inactivation of gene expression leads to the accumulation of diacylglycerol and the cessation of lipoteichoic acid formation in Bacillus subtilis
mutant isolated due to defects in DGK-1 controlled behaviour, altered behaviour compared to the wild-type enzyme, overview
additional information
determination of mutational defects/molecular lesions affecting the enzyme activity and splice forms of the enzyme, overview
kinase-defective dominant-negative mutant , impairs hepatocyte growth factor- and v-Src-induced cell scatter and migration, without affecting the loss of intercellular adhesions, impairs hepatocyre growth factor-induced cell spreading, lamellipodia formation, membrane ruffling, and focal adhesions remodeling and impairs hepatocyte growth factor-induced Rac activation and membrane targeting
additional information
downregulation of diacylglycerol kinase alpha by siRNA impairs hepatocyte growth factor- and v-Src-induced cell scatter and migration, without affecting the loss of intercellular adhesions, impairs hepatocyre growth factor-induced cell spreading, lamellipodia formation, membrane ruffling, and focal adhesions remodeling and impairs hepatocyte growth factor-induced Rac activation and membrane targeting
additional information
deletion mutants lacking respectively the entire C-terminal half of diacylglycerol kinase alpha or the last 13 amino acids PPPRSTNFFGFLS. Contrary to wild-type, mutants are not pulled down by immobilized GST-Src-SH3 fusion protein
mutants is not tyrosine phosphorylated upon coexpression with activated Src mutant Y527F. Enzymatic activity is not stimulated by hepatocyte growth factor cell stimulation
additional information
the ATP binding sequence of isozyme DGK2in strain rdgA contains the mutant GXDXXG motif leading to rapid retinal degeneration after birth
ratio of enzymic activity with substrates 1-stearoyl-2-linoleoyl-sn-glycerol to 1-stearoyl-2-arachidonoyl-sn-glycerol is 0.054
additional information
construction of deletion mutants, N- or C-terminal truncations inactivate the isozyme theta
additional information
mutation of the second glycine in the binding sequence motif GXGXXG of the ATP-binding site to aspartate or alanine renders the mutant enzymes catalytically inactive
additional information
expression of truncated FLAG-tagged protein lacking the 40 N-terminal amino acids, which includes the hydrophobic segment. Truncated protein maintains substrate specificity and increases catalytic rate constant. Truncated protein may be extracted with 1.5 M KCl at neutral pH value, while wild-type protein remains fully membrane bound; truncated form of the protein (DGKDELTAepsilon) lacking the 40 N-terminal amino acids. Full-length FLAG-DGKepsilon and truncated FLAG-DGKepsilon are both more specific for 1-stearoyl-2-arachidonoyl-sn-glycerol than for 1,2-dioleoyl-sn-glycerol. 1-Stearoyl-2-linoleoyl-sn-glycerol exhibits intermediate specificity for both forms of the enzyme. The truncated form of the enzyme maintains substrate specificity for lipids with an arachidonoyl moiety present at the sn-2 position. The truncation increases the catalytic rate constant for all three substrates and may suggest a role in the negative regulation of this enzyme
additional information
overexpression of wild-type diacylglycerol kinase alpha, but not of its kinase-dead mutant, markedly suppresses tumor necrosis factor alpha-induced apoptosis of AKI human melanoma cells and enhances the tumor necrosis factor alpha-stimulated transcriptional activity of transcription factor NF-kappaB. siRNA-mediated knock-down of diacylglycerol kinase alpha enhances the apoptosis. Overexpression of isoforms beta and gamma has no detectable effect on apoptosis
additional information
heterologous expression of diacylglycerol kinase gamma in COS-7 cells. Upon stimulation with epidermal growth factor, enzyme specifically interacts and co-localizes at the plasma membrane with beta2-chimaerin. Enzyme enhances epidermal growth factor-dependent translocation of beta2-chimaerin to the plasma membrane and markedly augments epidermal growth factor-dependent GTPase-activating protein activity of beta2-chimaerin
additional information
RNA interference-mediated knockdown of diacylglycerol kinase zeta leads to accelerated transferrin receptor exit from the lymphocyte endocytic recycling compartment back to the plasma membrane
additional information
in a female patient with a de novo balanced translocation, 46,X,t(X,2)(p11.2,q37)dn, who exhibits seizures, capillary abnormality, developmental delay, infantile hypotonia, and obesity, diacylglycerol kinase delta is disrupted at 2q37. Diacylglycerol kinase delta is involved in the etiology of seizures
additional information
diacylglycerol kinase delta has alternative splicing variants, type 1 DGKdelta1 and type 2 DGKdelta2, with calculated molecular masses of 130 and 134 kDa, respectively. HeLa cells express both type 1 and 2 DGKdelta, and COS7 cells express only type 2 DGKdelta. In DGKdelta-knockdown cells uptake of transferrin is reduced. DGKdelta2 is partially co-localized with clathrin or adaptor protein AP2alpha in COS7 cells. Mutants lacking binding ability to AP2alpha as well as kinase-negative mutants cannot compensate for the uptake of transferrin inhibited by siRNA treatment. Overexpression of wild-type diacylglycerol kinase delta2 completely recovers the transferrin uptake
additional information
expression of a peptide corresponding to a putative transmembrane segment which comprises approximately residues 20-40 and is found in all forms of mammalian diacylglycerol kinase epsilon. Peptide KKKKLILWTLCSVLLPVFITFWKKKKK-NH2 has increased helical content and significant blue shifts in the presence of anionic but not zwitterionic bilayer membranes. Peptide dimerizes and preferentially interacts with cholesterol in lipid films comprised of homogeneous mixtures of cholesterol and phosphatidylcholine, yet the presence of cholesterol in hydrated vesicle bilayers decreases its helical content
additional information
silencing of diacylglycerol kinase theta by siRNA expression inhibits cAMP-dependent CYP17 transcription. LXXLL motifs in diacylglycerol kinase theta mediate a direct interaction of steroidogenic factor 1 with the kinase and may facilitate binding of phosphatidic acid to the receptor
mutation results in a loss of a hydroxyl group and an essential residue of the cholesterol recognition/interaction amino acid consensus motif, leading to a higher activity than the wild-type protein. Ratio of enzymic activity with substrates 1-stearoyl-2-linoleoyl-sn-glycerol to 1-stearoyl-2-arachidonoyl-sn-glycerol is 0.107. Mutant gains preference for substrate 1,2-diarachidonoyl-sn-glycerol, with activities comparable to 1-stearoyl-2-arachidonoyl-sn-glycerol
additional information
mutation of the second glycine in the binding sequence motif GXGXXG of the ATP-binding site to aspartate or alanine renders the mutant enzymes catalytically inactive
mutation in sterile alpha-motif, mutant is largely monomeric in solution
additional information
overexpression of diacylglycerol kinase zeta blocks cells in G1 phase of cell cycle. Cell cycle arrest is accompanied by decreased levels of retinoblastoma protein phosphorylated on Ser-807/811. Down-regulation by siRNA increases the number of cells in both the S and G2/M phases of the cell cycle and prevents the cell cycle block characterizing C2C12 cell myogenic differentiation
additional information
deficiency for diacylglycerol kinase zeta results in impaired interleukin 12 and tumor necrosis factor alpha production following toll-like receptor stimulation in vitro and in vivo, increased resistance to endotoxin shock, and enhanced susceptibility to Toxoplasma gondii infection. Deficiency results in increased activation of the phosphatidylinositol 3-kinase-Akt pathway. Inhibition of phosphatidylinositol 3-kinase activity or treatment with phosphatidic acid can restore lipopolysaccharide-induced interleukin 12 production by diacylglycerol kinase zeta-deficient mice
additional information
diacylglycerol kinase delta knock-down mice reveal abnormal epiletic discharges and electrographic seizures in three out of six homozygotes
additional information
transgenic mice with cardiac-specific overexpression of diacylglycerol kinase zeta. Left ventricular chamber dilatation, reduction of left ventricular systolic function and increases in left ventricular weight and lung weight at 4 weeks after myocardial infarction are attenuated in transgenic mice compared with wild-type mice. In the noninfarct area, fibrosis fraction and upregulation of profibrotic genes, such as transforming growth factor-1, collagen type I, and collagen type III, are blocked in transgenic mice. Survival rate at 4 weeks after myocardial infarction is higher in transgenic mice than in wild-type
additional information
generation of heterozygous diacylglycerol kinase delta whole-body knockout mice. Diacylglycerol kinase delta haploinsufficiency increases diacylglycerol content, reduces peripheral insulin sensitivity, insulin signaling, and glucose transport, and leads to age-dependent obesity. Metabolic flexibility is impaired
additional information
creation of thoracic transverse aortic constriction in transgenic mice with cardiac-specific overexpression of diacylglycerol kinase zeta and wild-type mice. Increases in heart weight at 4 weeks after thoracic transverse aortic constriction are attenuated in diacylglycerol kinase zeta transgenic mice compared with wild-type mice. Increases in interventricular septal thickness, dilatation of the left ventricular cavity, and decreases in left ventricular systolic function in wild-type mice are observed at 4 weeks after surgery and are attenuated in diacylglycerol kinase zetatransgenic mice. Contrary to wild-type, cardiac fibrosis and gene induction of type I and type III collagens, but not transforming growth factor are blocked in diacylglycerol kinase zeta transgenic mice
additional information
generation of double transgenic mice with cardiac-specific overexpression of both diacylglycerol kinase zeta and G-protein subunit alphaq. Diacylglycerol kinase zeta prevents cardiac dysfunction, determined by dilatation of left ventricular dimensions, reduction of left ventricular fractional shortening, and marked increases in left ventricular end-diastolic pressure in G-protein subunit alphaq transgenic mice. Translocation of protein kinase C isoforms, phosphorylation activity of c-jun N-terminal kinase and p38 mitogen-activated protein kinase in G-protein subunit alphaq transgenic mice are attenuated by diacylglycerol kinase zeta?. Diacylglycerol kinase zeta improves the survival rate of G-protein subunit alphaq transgenic mice
additional information
construction of mutant protein lacking the regulatory N-terminus and both C1 domains. Mutant is enzymatically active. deletion analysis reveals that the C1 domains are essential for plasma membrane targeting in intact cells but unnecessary for catalytic activity. The C-terminal sequence is required for membrane-binding in a phosphatidic acid-dependent manner. In the absence of the calcium binding domain, receptor-dependent translocation of the truncated protein is regulated by phosphorylation of residue Y335
additional information
in mouse ventricular myocytes overexpressing diaclyglycerol kinase zeta, the effect induced by endothelin-1 on Ca2+ transients and cell shortening are abolished
additional information
generation of mice lacking both diacylglycerol kinase alpha and zeat. Absence of both diacylglycerol kinases results in a severe decrease in the number of CD4+CD8- and CD4-CD8+ single-positive thymocytes correlating with increased diacylglycerol kinase-mediated signaling. Positive selection, but not negative selection, is impaired in diacylglycerol kinase alpha-/- zeta -/- mice. The developmental blockage in diacylglycerol kinase alpha-/- zeta -/- mice can be partially overcome by treatment with phosphatidic acid. Decreased diacylglycerol kinase activity also promotes thymic lymphomagenesis accompanying elevated Ras and Erk1/2 activation
additional information
expression of isolated His-tagged sterile alpha-motif domain of diacylglycerol kinase delta1, comprised of residues 1097-1164. The domain forms large aggregates with a molecular weight of 250000 Dalton or greater, while calculated monomer molecular weight is 9500 Dalton
additional information
nuclear export signal mutant forms of DGK-zeta accumulate in the nucleus to a much greater extent than wild type DGK-zeta
mutation in sterile alpha-motif, mutant is largely monomeric in solution
additional information
generation of transgenic tobacco plants constitutively expressing rice diacylglycerol kinase. Overexpression results in enhanced resistance against infection by tobacco mosaic virus and Phytophthora parasitica var. nicotianae
inactive mutant of diacylglycerol kinase beta due to replacement of ATP-binding domain GxGxxG with GxDxxG. In contrast to the filamentous image of the wild type, mutant is diffusely distributed throughout the cytoplasm
additional information
diacylglycerol kinase zeta siRNA tranfection decreases H2O2-induced apoptosis. Overexpression of kinase-dead diacylglycerol kinase zeta significantly increases protein kinase D phosphorylation
additional information
antisense silencing of diacylglacerol kinase isoform delta, but not alpha, expression is sufficient to prevent the effect of high glucose on protein kinase alpha activity, insulin receptor signaling, and glucose uptake
site-directed mutagenesis, 4.0% of wild-type activity, reduced stimulation by Ca2+ and phosphatidylserine compared to the wild-type enzyme
additional information
construction of deletion mutants DELTA196, lacking the RVH motif and the EF hand, and DELTA332, lacking the RVH motif, the EF hand, and the C1 domain, mutant DELTA332 shows 50% of wild-type activity
solubilization of the active enzyme from aggregates after recombinant expression in yeast
overexpression of wild-type diacylglycerol kinase alpha, but not of its kinase-dead mutant, markedly suppresses tumor necrosis factor alpha-induced apoptosis of AKI human melanoma cells and enhances the tumor necrosis factor alpha-stimulated transcriptional activity of transcription factor NF-kappaB. siRNA-mediated knock-down of diacylglycerol kinase alpha enhances the apoptosis. Overexpression of isoforms beta and gamma has no detectable effect on apoptosis
in a female patient with a de novo balanced translocation, 46,X,t(X,2)(p11.2,q37)dn, who exhibits seizures, capillary abnormality, developmental delay, infantile hypotonia, and obesity, diacylglycerol kinase delta is disrupted at 2q37.Diacylglycerol kinase delta is involved in the etiology of seizures
diacylglycerol kinases are required for anchorage-independent growth in MDA-MB-231 cells. Activity is induced by hepatocyte growth factor
patients with type 2 diabetes mellitus display reduced diacylglycerol kinase delta expression and activity in skeletal muscle
patients with certain forms of systematic vasculitis, such as Wegeners granulomatosis, have circulating antineutrophil cytoplasmic antibodies. Diacylglycerol kinase is selectively activated by circulating antineutrophil cytoplasmic antibodies and the generated phosphatidic acid is responsible for promoting neutrophil adhesion, in part through integrin activation
study on genetic basis of bipolar disorder. Of 37 single nucleotide polymorphisms selected for individual genotyping, the strongest association signal is detected at a marker within the diacylglycerol kinase eta. Several genes, each of modest effect, reproducibly influence disease risk. Bipolar disorder may be a polygenic disease
enzyme is able to remove 1-stearoyl-2-arachidonoylglycerol, the precursor of the endocannabinoid 2-arachidonoyl glycerol; enzyme is able to remove 1-stearoyl-2-arachidonoylglycerol, the precursor of the endocannabinoid 2-arachidonoyl glycerol
diaclyglycerol kinase activity is reduced by oxidative stress in glomerular mesangial cells cultured under high glucose conditions. Antioxidants, including D-alpha-tocopherol and probucol may improve hyperglycemia-induced diacylglycerol-protein kinase C activation by enhancing diacylglycerol kinase activity
generation of a soluble mutant selection assay based on a library of random diacylglycerol kinase delta1 mutants of sterile alpha-motif and murine dihydrofolate reductase as the selectable marker
deficiency for diacylglycerol kinase zeta results in impaired interleukin 12 and tumor necrosis factor alpha production following toll-like receptor stimulation in vitro and in vivo, increased resistance to endotoxin shock, and enhanced susceptibility to Toxoplasma gondii infection
diacylglycerol kinase delta knock-down mice reveal abnormal epiletic discharges and electrographic seizures in three out of six homozygotes
transgenic mice with cardiac-specific overexpression of diacylglycerol kinase zeta. Left ventricular chamber dilatation, reduction of left ventricular systolic function and increases in left ventricular weight and lung weight at 4 weeks after myocardial infarction are attenuated in transgenic mice compared with wild-type mice. In the noninfarct area, fibrosis fraction and upregulation of profibrotic genes, such as transforming growth factor-1, collagen type I, and collagen type III, are blocked in transgenic mice. Survival rate at 4 weeks after myocardial infarction is higher in transgenic mice than in wild-type
comparison of transgenic mice with cardiac-specific overexpression of diacylglycerol kinase zeta and wild-type mice in streptozotocin-induced diabetic and non-diabetic conditions. After 8 weeks, decreases in heart weight and heart weight/body weight ratio in diabetic wild-type mice are inhibited in transgenic mice. Decreases in left ventricular end-diastolic diameter and fractional shortening observed in wild-type mice are attenuated in transgenic mice. Thinning of the interventricular septum and the posterior wall in diabetic wild-type hearts are blocked in transgenic mice. Reduction of transverse diameter of cardiomyocytes isolated from the left ventricle in diabetic wild-type mice is attenuated in transgenic mice. Cardiac fibrosis was much less in diabetic transgenic than in diabetic wild-type mice
diacylglycerol kinase delta haploinsufficiency increases diacylglycerol content, reduces peripheral insulin sensitivity, insulin signaling, and glucose transport, and leads to age-dependent obesity. Metabolic flexibility is impaired
creation of thoracic transverse aortic constriction in transgenic mice with cardiac-specific overexpression of diacylglycerol kinase zeta and wild-type mice. Increases in heart weight at 4 weeks after thoracic transverse aortic constriction are attenuated in diacylglycerol kinase zeta transgenic mice compared with wild-type mice. Increases in interventricular septal thickness, dilatation of the left ventricular cavity, and decreases in left ventricular systolic function in wild-type mice are observed at 4 weeks after surgery and are attenuated in diacylglycerol kinase zetatransgenic mice. Contrary to wild-type, cardiac fibrosis and gene induction of type I and type III collagens, but not transforming growth factor are blocked in diacylglycerol kinase zeta transgenic mice
diacylglycerol kinase zeta blocks cardiac dysfunction and progression to lethal heart failure by activated G-protein subunit alphaq protein without detectable adverse effects in the in-vivo heart
DGKepsilon is a therapeutic target to prevent cardiac hypertrophy and progression to heart failure
generation of transgenic tobacco plants constitutively expressing rice diacylglycerol kinase. Overexpression results in enhanced resistance against infection by tobacco mosaic virus and Phytophthora parasitica var. nicotianae
DGKzeta may be a therapeutic target to prevent cardiac hypertrophy and progression to heart failure