Sequence of PDE10_RAT

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
3',5'-cyclic-nucleotide phosphodiesterase
Q9QYJ6
Rattus norvegicus
794
90161
Reaction
nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q9QYJ6|3',5'-cyclic-nucleotide phosphodiesterase|EC 3.1.4.17|Rattus norvegicus|Swiss-Prot
MEDGPSNNASCFRRLTECFLSPSLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRK
NNKAEDEPSPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNHLLLYELSSIIRIATKAD
GFALYFLGECNNSLCVFTPPGMKEGQPRLIPAGPITQGTTISAYVAKSRKTLLVEDILGD
ERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWA
SVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALF
QVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADP
RFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCAL
ALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWQGLMHFNLPARICRDIELFHFDIG
PFENMWPGIFVYMIHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAI
LQNNNGLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTV
SILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLHNQS
HRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKRD
EVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLNQWEKVIRGEETAMWISGPAT
SKSTSEKPTRKVDD
Download this sequence
in fasta format
Download all sequences for 3.1.4.17
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
440754
Fujishige K.,Kotera J.,Omori K.
Striatum- and testis-specific phosphodiesterase PDE10A isolation and characterization of a rat PDE10A.
Eur. J. Biochem.
266
1118-1127
1999
440755
O'Connor V.,Genin A.,Davis S.,Karishma K.K.,Doyere V.,De Zeeuw C.I.,Sanger G.,Hunt S.P.,Richter-Levin G.,Mallet J.,Laroche S.,Bliss T.V.P.,French P.J.
Differential amplification of intron-containing transcripts reveals long term potentiation-associated up-regulation of specific Pde10A phosphodiesterase splice variants.
J. Biol. Chem.
279
15841-15849
2004
440757
Chappie T.A.,Humphrey J.M.,Allen M.P.,Estep K.G.,Fox C.B.,Lebel L.A.,Liras S.,Marr E.S.,Menniti F.S.,Pandit J.,Schmidt C.J.,Tu M.,Williams R.D.,Yang F.V.
Discovery of a series of 6,7-dimethoxy-4-pyrrolidylquinazoline PDE10A inhibitors.
J. Med. Chem.
50
182-185
2007