Sequence of F5SMW6_9GAMM

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
coniferyl-aldehyde dehydrogenase
F5SMW6
Psychrobacter sp. 1501(2011)
228
25349
Reaction
coniferyl aldehyde + H2O + NAD(P)+ = ferulate + NAD(P)H + 2 H+
Sequences with same EC No.
Sequence
show sequence in normal format
>F5SMW6|coniferyl-aldehyde dehydrogenase|EC 1.2.1.68|Psychrobacter sp. 1501(2011)|TrEMBL
MTEQNLTDNLNPNNLDHNNDSEQDVLDSNSTQSAKVTDEQVINWIKSRRSIGNLTIPAPK
KNQLEVAIECAMTAPDHKKLQPWRFIVTEGQQRHALGRALLAAAEAKALREGTELDERSA
EKTLKMPLRAPMIITVVTNMQYHEKVPEFEQLLSAGAAVQNLILALKAQGFSTVWRTGPL
ANEPAVKTYFNVGAEDYVTAFVYVGTSHCVMPSRGDIETADFIHYDSE
Download this sequence
in fasta format
Download all sequences for 1.2.1.68
in fasta format
in csv (Excel, OpenOffice) format