Sequence of EOGT_DROME

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
protein O-GlcNAc transferase
Q9VQB7
Drosophila melanogaster
520
60083
Reaction
UDP-N-acetyl-alpha-D-glucosamine + [protein]-L-serine = UDP + [protein]-3-O-(N-acetyl-beta-D-glucosaminyl)-L-serine
Sequences with same EC No.
Sequence
show sequence in normal format
>Q9VQB7|protein O-GlcNAc transferase|EC 2.4.1.255|Drosophila melanogaster|Swiss-Prot
MPILPILIGILHLSLAEDAKHLDGFSLPSLPSEHLIRYLNTFPKLKQQLPTNLTGKGTIS
SACWGHERDCTPAGRFQTPQCPGEHTGWARSKEAQVRTFYNQADFGYIQEQLSQLTPQCV
PTYLGDSSLECTHYLRFCRGRNLLFDFRGLEQREERIRYHMDVLGPGQLLGHCKLNRTRL
SGEMEHIGSALQSWGPELRNFDVLPHPVLESGLCDVVVNTPTFIMKIDATYNMYHHFCDF
FNLYASLFVNQSHPAAFNTDVQILIWETYPYDSPFRDTFKAFSQRPVWTLSDVEGKRVCF
KNVVLPLLPRMIFGLFYNTPIIQGCSNSGLFRAFSEFILHRLQIPYKPPQQKIRITYLSR
RTKYRQVLNEDELLAPLEANDKYDVQRVSYERLPFTNQLAITRNTDILIGMHGAGLTHLL
FLPNWACIFELYNCEDPNCYKDLARLRGVRYRTWEQRDLVYPQDEGHHPEGGAHAKFTNY
SFDVKEFVHLVDGAAEEILSHKEFPRRASENPSKTQRNEL
Download this sequence
in fasta format
Download all sequences for 2.4.1.255
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
409126
Sakaidani Y.,Nomura T.,Matsuura A.,Ito M.,Suzuki E.,Murakami K.,Nadano D.,Matsuda T.,Furukawa K.,Okajima T.
O-Linked-N-acetylglucosamine on extracellular protein domains mediates epithelial cell-matrix interactions.
Nat. Commun.
2
583-583
2011
409127
Adams M.D.,Celniker S.E.,Holt R.A.,Evans C.A.,Gocayne J.D.,Amanatides P.G.,Scherer S.E.,Li P.W.,Hoskins R.A.,Galle R.F.,George R.A.,Lewis S.E.,Richards S.,Ashburner M.,Henderson S.N.,Sutton G.G.,Wortman J.R.,Yandell M.D.,Zhang Q.,Chen L.X.,Brandon R.C.,Rogers Y.-H.C.,Blazej R.G.,Champe M.,Pfeiffer B.D.,Wan K.H.,Doyle C.,Baxter E.G.,Helt G.,Nelson C.R.,Miklos G.L.G.,Abril J.F.,Agbayani A.,An H.-J.,Andrews-Pfannkoch C.,Baldwin D.,Ballew R.M.,Basu A.,Baxendale J.,Bayraktaroglu L.,Beasley E.M.,Beeson K.Y.,Benos P.V.,Berman B.P.,Bhandari D.,Bolshakov S.,Borkova D.,Botchan M.R.,Bouck J.,Brokstein P.,Brottier P.,Burtis K.C.,Busam D.A.,Butler H.,Cadieu E.,Center A.,Chandra I.,Cherry J.M.,Cawley S.,Dahlke C.,Davenport L.B.,Davies P.,de Pablos B.,Delcher A.,Deng Z.,Mays A.D.,Dew I.,Dietz S.M.,Dodson K.,Doup L.E.,Downes M.,Dugan-Rocha S.,Dunkov B.C.,Dunn P.,Durbin K.J.,Evangelista C.C.,Ferraz C.,Ferriera S.,Fleischmann W.,Fosler C.,Gabrielian A.E.,Garg N.S.,Gelbart W.M.,Glasser K.,Glodek A.,Gong F.,Gorrell J.H.,Gu Z.,Guan P.,Harris M.,Harris N.L.,Harvey D.A.,Heiman T.J.,Hernandez J.R.,Houck J.,Hostin D.,Houston K.A.,Howland T.J.,Wei M.-H.,Ibegwam C.,Jalali M.,Kalush F.,Karpen G.H.,Ke Z.,Kennison J.A.,Ketchum K.A.,Kimmel B.E.,Kodira C.D.,Kraft C.L.,Kravitz S.,Kulp D.,Lai Z.,Lasko P.,Lei Y.,Levitsky A.A.,Li J.H.,Li Z.,Liang Y.,Lin X.,Liu X.,Mattei B.,McIntosh T.C.,McLeod M.P.,McPherson D.,Merkulov G.,Milshina N.V.,Mobarry C.,Morris J.,Moshrefi A.,Mount S.M.,Moy M.,Murphy B.,Murphy L.,Muzny D.M.,Nelson D.L.,Nelson D.R.,Nelson K.A.,Nixon K.,Nusskern D.R.,Pacleb J.M.,Palazzolo M.,Pittman G.S.,Pan S.,Pollard J.,Puri V.,Reese M.G.,Reinert K.,Remington K.,Saunders R.D.C.,Scheeler F.,Shen H.,Shue B.C.,Siden-Kiamos I.,Simpson M.,Skupski M.P.,Smith T.J.,Spier E.,Spradling A.C.,Stapleton M.,Strong R.,Sun E.,Svirskas R.,Tector C.,Turner R.,Venter E.,Wang A.H.,Wang X.,Wang Z.-Y.,Wassarman D.A.,Weinstock G.M.,Weissenbach J.,Williams S.M.,Woodage T.,Worley K.C.,Wu D.,Yang S.,Yao Q.A.,Ye J.,Yeh R.-F.,Zaveri J.S.,Zhan M.,Zhang G.,Zhao Q.,Zheng L.,Zheng X.H.,Zhong F.N.,Zhong W.,Zhou X.,Zhu S.C.,Zhu X.,Smith H.O.,Gibbs R.A.,Myers E.W.,Rubin G.M.,Venter J.C.
The genome sequence of Drosophila melanogaster.
Science
287
2185-2195
2000
409128
Misra S.,Crosby M.A.,Mungall C.J.,Matthews B.B.,Campbell K.S.,Hradecky P.,Huang Y.,Kaminker J.S.,Millburn G.H.,Prochnik S.E.,Smith C.D.,Tupy J.L.,Whitfield E.J.,Bayraktaroglu L.,Berman B.P.,Bettencourt B.R.,Celniker S.E.,de Grey A.D.N.J.,Drysdale R.A.,Harris N.L.,Richter J.,Russo S.,Schroeder A.J.,Shu S.Q.,Stapleton M.,Yamada C.,Ashburner M.,Gelbart W.M.,Rubin G.M.,Lewis S.E.
Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
Genome Biol.
3
0-0
2002
409129
Stapleton M.,Carlson J.W.,Brokstein P.,Yu C.,Champe M.,George R.A.,Guarin H.,Kronmiller B.,Pacleb J.M.,Park S.,Wan K.H.,Rubin G.M.,Celniker S.E.
A Drosophila full-length cDNA resource.
Genome Biol.
3
0-0
2002