Literature summary for 2.7.1.107 extracted from

Glukhov, E.; Shulga, Y.V.; Epand, R.F.; Dicu, A.O.; Topham, M.K.; Deber, C.M.; Epand, R.M.
Membrane interactions of the hydrophobic segment of diacylglycerol kinase epsilon (2007), Biochim. Biophys. Acta, 1768, 2549-2558.

Search for more literature for 2.7.1.107

Protein Variants

Protein Variants	Comment	Organism
additional information	expression of a peptide corresponding to a putative transmembrane segment which comprises approximately residues 20-40 and is found in all forms of mammalian diacylglycerol kinase epsilon. Peptide KKKKLILWTLCSVLLPVFITFWKKKKK-NH2 has increased helical content and significant blue shifts in the presence of anionic but not zwitterionic bilayer membranes. Peptide dimerizes and preferentially interacts with cholesterol in lipid films comprised of homogeneous mixtures of cholesterol and phosphatidylcholine, yet the presence of cholesterol in hydrated vesicle bilayers decreases its helical content	Homo sapiens

Organism

Organism	UniProt	Comment	Textmining
Homo sapiens	P52429	diacylglycerol kinase epsilon	-

Use of this online version of BRENDA is free under the CC BY 4.0 license. See terms of use for full details.

Release 2023.1 (January 2023)