Information on EC 3.4.23.32 - Scytalidopepsin B

Word Map on EC 3.4.23.32
Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Specify your search results
Select one or more organisms in this record:
Show additional data
Do not include text mining results
Include (text mining) results (more...)
Include results (AMENDA + additional results, but less precise; more...)

The enzyme appears in viruses and cellular organisms

EC NUMBER
COMMENTARY hide
3.4.23.32
-
RECOMMENDED NAME
GeneOntology No.
Scytalidopepsin B
REACTION
REACTION DIAGRAM
COMMENTARY hide
ORGANISM
UNIPROT
LITERATURE
Hydrolysis of proteins with broad specificity, cleaving Phe24-/-Phe, but not Leu15-Tyr and Phe25-Tyr in the B chain of insulin
show the reaction diagram
REACTION TYPE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
hydrolysis of peptide bond
-
-
aspartic endopeptidase
-
CAS REGISTRY NUMBER
COMMENTARY hide
104781-89-7
-
ORGANISM
COMMENTARY hide
LITERATURE
UNIPROT
SEQUENCE DB
SOURCE
similar enzyme
-
-
Manually annotated by BRENDA team
similar enzyme
-
-
Manually annotated by BRENDA team
SUBSTRATE
PRODUCT                       
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
Reversibility
r=reversible
ir=irreversible
?=not specified
2-aminobenzoyl-KLAPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLA + PSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLASSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLA + SSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLDPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLD + PSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLDSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLD + SSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLEPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLE + PSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLESPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLES + PSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLESSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLE + SSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLFPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLF + PSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLFSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLF + SSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLGPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLG + PSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLGSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLG + SSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLHPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLH + PSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLHSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLH + SSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLKPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLK + PSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLKSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLK + SSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLLPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLL + PSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLLSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLL + SSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLMPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLM + PSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLMSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLM + SSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLNPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLN + PSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLNSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLN + SSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLPPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLP + PSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLPSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLP + SSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLQPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLQ + PSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLQSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLQ + SSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLRPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLR + PSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLRSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLR + SSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLSPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLS + PSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLSSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLS + SSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLVPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLV + PSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLVSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLV + SSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLYPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLY + PSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-KLYSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine] + H2O
2-aminobenzoyl-KLY + SSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
show the reaction diagram
-
-
-
-
?
Angiotensin I + H2O
?
show the reaction diagram
Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser + H2O
?
show the reaction diagram
-
preferentially cleaved at His-Pro and His-Leu, less rapidly at Tyr-Ile
-
-
-
Benzyloxycarbonyl-Ala-Ala-Lys-Ala-Ala-Ala + H2O
Benzyloxycarbonyl-Ala-Ala-Lys + Ala-Ala-Ala
show the reaction diagram
-
slow hydrolysis
-
-
Benzyloxycarbonyl-Ala-Lys-Ala-Ala-Ala + H2O
Benzyloxycarbonyl-Ala-Lys + Ala-Ala-Ala
show the reaction diagram
-
slow hydrolysis
-
-
Benzyloxycarbonyl-Lys-Leu-Ala-Ala + H2O
Benzyloxycarbonyl-Lys-Leu-Ala + Ala
show the reaction diagram
-
slow hydrolysis
-
-
Benzyloxycarbonyl-Phe-Leu-Ala-Ala + H2O
Benzyloxycarbonyl-Phe-Leu-Ala + Ala
show the reaction diagram
-
slow hydrolysis
-
-
Benzyloxycarbonyl-Phe-Tyr-Ala-Ala + H2O
Benzyloxycarbonyl-Phe-Tyr-Ala + Ala
show the reaction diagram
-
slow hydrolysis
-
-
casein + H2O
hydrolyzed casein
show the reaction diagram
D-2,3-diaminopropionic acid(N-methylanthraniloyl)-GFKFFALRK(2,4-dinitrophenol) + H2O
D-2,3-diaminopropionic acid(N-methylanthraniloyl)-GFKFF + ALRK(2,4-dinitrophenol)
show the reaction diagram
-
-
-
-
?
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O
FVNQHLCGSHLVE + A + LYLVCGERGF + FY + TPKA
show the reaction diagram
-
i.e. insulin B chain, cleavage site specificity
-
-
?
Hemoglobin + H2O
Hydrolyzed hemoglobin
show the reaction diagram
Oxidized insulin B-chain + H2O
Hydrolyzed insulin B-chain
show the reaction diagram
Proangiotensin + H2O
?
show the reaction diagram
-
rapid hydrolysis of His6-Pro7 bond, additional cleavage of the Tyr4-Ile5 bond
-
-
-
Z-Phe-Xaa-Ala-Ala + H2O
Z-Phe + Xaa-Ala-Ala
show the reaction diagram
-
C-terminal cleavage site specificity, low activity
-
-
?
Z-Xaa-Leu-Ala-Ala + H2O
Z-Xaa + Leu-Ala-Ala
show the reaction diagram
-
C-terminal cleavage site specificity, low activity
-
-
?
additional information
?
-
NATURAL SUBSTRATES
NATURAL PRODUCTS
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
REVERSIBILITY
r=reversible
ir=irreversible
?=not specified
additional information
?
-
-
the enzyme is involved in protein degradation in wood destroying by the fungus
-
-
-
METALS and IONS
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
CuCl2
-
10 mM, activates
MnCl2
-
10 mM, activates
INHIBITORS
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
1,2-epoxy-3-(4-nitrophenoxy)propane
1-diazo-3-phenyl-2-propanone
-
modifies active site residue Asp98
Ac-FKF-(3S,4S)-phenylstatinyl-LR-NH
-
-
acetyl-Phe--Lys-Phe-(3S,4S)-phenylstatinyl-Leu-Arg-NH2
-
SGP transition state mimic inhibitor
N-bromosuccinimide
-
-
NaCl
-
a substantial decrease of the SGP catalytic efficiency (kcat/Km) is observed as the NaCl concentration is increases up to 1 M, while in the range up to 200 mM NaCl the effect is mainly in Km because there is no significant decrease in kcat values. A significant decrease in the kcat values is observed as the salt concentration is further increased from 200 to 800 mM NaCl
additional information
-
KM VALUE [mM]
SUBSTRATE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
0.0022
2-aminobenzoyl-KLAPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0023
2-aminobenzoyl-KLASSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0039
2-aminobenzoyl-KLDPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0046
2-aminobenzoyl-KLDSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.004
2-aminobenzoyl-KLESPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0008
2-aminobenzoyl-KLESSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0002
2-aminobenzoyl-KLFPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0012
2-aminobenzoyl-KLFSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.002
2-aminobenzoyl-KLGPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0046
2-aminobenzoyl-KLGSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0001
2-aminobenzoyl-KLHPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0004
2-aminobenzoyl-KLHSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.00055
2-aminobenzoyl-KLKPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0005
2-aminobenzoyl-KLKSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0016
2-aminobenzoyl-KLLSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0008
2-aminobenzoyl-KLMSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.00026
2-aminobenzoyl-KLNPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.003
2-aminobenzoyl-KLNSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0004
2-aminobenzoyl-KLPSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0009
2-aminobenzoyl-KLQPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0008
2-aminobenzoyl-KLQSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0003
2-aminobenzoyl-KLRPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0008
2-aminobenzoyl-KLRSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0014
2-aminobenzoyl-KLSPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0004
2-aminobenzoyl-KLSSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0017
2-aminobenzoyl-KLVSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.00025
2-aminobenzoyl-KLYPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.0011
2-aminobenzoyl-KLYSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.000065
D-2,3-diaminopropionic acid(N-methylanthraniloyl)-GFKFFALRK(2,4-dinitrophenol)
-
-
TURNOVER NUMBER [1/s]
SUBSTRATE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
1.6
2-aminobenzoyl-KLAPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
6
2-aminobenzoyl-KLASSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.6
2-aminobenzoyl-KLDPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
17
2-aminobenzoyl-KLDSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.4
2-aminobenzoyl-KLESPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.2
2-aminobenzoyl-KLESSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
13
2-aminobenzoyl-KLFPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
200
2-aminobenzoyl-KLFSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.4
2-aminobenzoyl-KLGPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
3.6
2-aminobenzoyl-KLGSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
33
2-aminobenzoyl-KLHPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
145
2-aminobenzoyl-KLHSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
3.5
2-aminobenzoyl-KLKPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
8
2-aminobenzoyl-KLKSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
7.7
2-aminobenzoyl-KLLSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
105
2-aminobenzoyl-KLMSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
6.5
2-aminobenzoyl-KLNPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
198
2-aminobenzoyl-KLNSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
7.7
2-aminobenzoyl-KLPSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.4
2-aminobenzoyl-KLQPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.8
2-aminobenzoyl-KLQSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
1.1
2-aminobenzoyl-KLRPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
15
2-aminobenzoyl-KLRSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.03
2-aminobenzoyl-KLSPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.063
2-aminobenzoyl-KLSSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
0.048
2-aminobenzoyl-KLVSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
8.7
2-aminobenzoyl-KLYPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
86
2-aminobenzoyl-KLYSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
34.8
D-2,3-diaminopropionic acid(N-methylanthraniloyl)-GFKFFALRK(2,4-dinitrophenol)
Scytalidium lignicola
-
-
kcat/KM VALUE [1/mMs-1]
SUBSTRATE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
700
2-aminobenzoyl-KLAPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40654
2600
2-aminobenzoyl-KLASSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40641
150
2-aminobenzoyl-KLDPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40653
3700
2-aminobenzoyl-KLDSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40640
100
2-aminobenzoyl-KLESPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40657
250
2-aminobenzoyl-KLESSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40644
65000
2-aminobenzoyl-KLFPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40648
167000
2-aminobenzoyl-KLFSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40632
200
2-aminobenzoyl-KLGPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40656
800
2-aminobenzoyl-KLGSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40643
330000
2-aminobenzoyl-KLHPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40647
363000
2-aminobenzoyl-KLHSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40631
6400
2-aminobenzoyl-KLKPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40651
16000
2-aminobenzoyl-KLKSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40636
4800
2-aminobenzoyl-KLLSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40639
131000
2-aminobenzoyl-KLMSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40633
26000
2-aminobenzoyl-KLNPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40650
66000
2-aminobenzoyl-KLNSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40635
19000
2-aminobenzoyl-KLPSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40638
400
2-aminobenzoyl-KLQPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40655
1000
2-aminobenzoyl-KLQSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40642
3700
2-aminobenzoyl-KLRPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40652
19000
2-aminobenzoyl-KLRSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40637
20
2-aminobenzoyl-KLSPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40658
160
2-aminobenzoyl-KLSSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40645
30
2-aminobenzoyl-KLVSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40646
35000
2-aminobenzoyl-KLYPSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40649
78000
2-aminobenzoyl-KLYSSKQ-[N-(2,4-dinitrophenyl)-ethylenediamine]
Scytalidium lignicola
-
in 100 mM sodium acetate buffer (pH 4.5) at 37°C
40634
SPECIFIC ACTIVITY [µmol/min/mg]
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
additional information
pH OPTIMUM
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
2
-
substrate casein
2.7
-
casein
2.9
-
hemoglobin
3.2
-
hemoglobin
pH RANGE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
1.3 - 3.5
-
1.3: about 80% of activity maximum, 3.5: about 35% of activity maximum
2 - 5
-
2: about 30% of activity maximum, 5: about 50% of activity maximum, hemoglobin
TEMPERATURE OPTIMUM
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
TEMPERATURE RANGE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
37 - 68
-
37°C: about 30% of activity maximum, 68°C: about 50% of activity maximum
pI VALUE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
LOCALIZATION
ORGANISM
UNIPROT
COMMENTARY hide
GeneOntology No.
LITERATURE
SOURCE
-
the enzyme is secreted
-
Manually annotated by BRENDA team
MOLECULAR WEIGHT
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
21969
-
1 * 21969, amino acid sequence calculation
21970
-
Scytalidium lignicolum, calculation from amino acid sequence
22000
-
Scytalidium lignicolum, gel filtration
32000
-
Lentinus edodes, gel filtration
36000
-
Ganoderma lucidum, gel filtration
40000
-
1 * 40000, Lentinus edodes, SDS-PAGE
SUBUNITS
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
monomer
additional information
-
molecular structure analysis
POSTTRANSLATIONAL MODIFICATION
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
additional information
Crystallization/COMMENTARY
ORGANISM
UNIPROT
LITERATURE
enzyme-(acetyl-FKF-(3S,4S)-phenylstatinyl)-LR-NH2 complex and enzyme-acetyl-FKF(2R,3S)-phenylisoseryl-ALR-NH2 complex. Native crystals of the enzyme are grown at room temperature by the hanging-drop vapor diffusion method from 42% saturated ammonium sulfate, 10% ethylene glycol and 0.1 M sodium acetate buffer (pH 4.0). These crystals are then soaked in solutions of varying concentrations of the transition state analogs (acetyl-FKF-(3S,4S)-phenylstatinyl)-LR-NH2 and acetyl-FKF(2R,3S)-phenylisoseryl-ALR-NH2
-
purified enzyme complexed with angiotensin II, hanging drop method, room temperature, from 42% saturated ammonium sulfate, 0.1 M sodium acetate, pH 4.0, 10% v/v ethylene glycol, crystals are soaked in cryosolution containing 30% glvcerol, 45% saturated ammonium sulfate,and 0.1 M sodium acetate, pH 4.0, heavy atom derivatizing, X-ray diffraction structure determination and analysis at 1.9-2.5 A resolution, molecular modeling and multiple isomorphous replacement phasing
-
the three-dimensional structure of SGP is determined by X-ray crystallography. The polypeptide folds into a beta-sandwich that has seven antiparallel beta-strands in each of the two sheets
-
pH STABILITY
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
1.5 - 5
-
37°C, 20 h
30754
3.2 - 5.2
8 - 9.5
-
in the pH range 8.0-9.5, the enzyme becomes irreversibly inactivated
709118
TEMPERATURE STABILITY
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
55
-
pH 4.0, 30 min, complete loss of activity
58
-
pH 4, 30 min, complete loss of activity
60
-
pH 4.0, 15 min, stable below
68
-
pH 4.0, 15 min, complete loss of activity
Purification/COMMENTARY
ORGANISM
UNIPROT
LITERATURE
Cloned/COMMENTARY
ORGANISM
UNIPROT
LITERATURE
DNA and amino acid sequence determination and analysis, expression in Saccharomyces cerevisiae with propper processing prior to secretion
-
ENGINEERING
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
E136A
-
mutant loses the ability for self-activation and cleavage of the propeptide. Mutant has no peptidase activity
Q53A
-
mutant loses the ability for self-activation and cleavage of the propeptide. Mutant has no peptidase activity
Q53E
-
mutant loses the ability for self-activation and cleavage of the propeptide. Mutant has no peptidase activity