Sequence of P4H13_ARATH

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
procollagen-proline 4-dioxygenase
F4ILF8
Arabidopsis thaliana
274
31424
Reaction
procollagen L-proline + 2-oxoglutarate + O2 = procollagen trans-4-hydroxy-L-proline + succinate + CO2
Sequences with same EC No.
Sequence
show sequence in normal format
>F4ILF8|procollagen-proline 4-dioxygenase|EC 1.14.11.2|Arabidopsis thaliana|Swiss-Prot
MRSYGKEKKLVFPYVFIACCFFLAIFGFCFFNLFSQGISFSEIPTTRRSVNDETDSLDHG
SSVSNIPFHGLSWNPRVFYLPNFATKQQCEAVIDMAKPKLKPSTLALRKGETAETTQNYR
SLHQHTDEDESGVLAAIEEKIALATRFPKDYYESFNILRYQLGQKYDSHYDAFHSAEYGP
LISQRVVTFLLFLSSVEEGGETMFPFENGRNMNGRYDYEKCVGLKVKPRQGDAIFFYNLF
PNGTIDQTSLHGSCPVIKGEKWVATKWIRDQTYD
Download this sequence
in fasta format
Download all sequences for 1.14.11.2
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
438945
Lin X.,Kaul S.,Rounsley S.D.,Shea T.P.,Benito M.-I.,Town C.D.,Fujii C.Y.,Mason T.M.,Bowman C.L.,Barnstead M.E.,Feldblyum T.V.,Buell C.R.,Ketchum K.A.,Lee J.J.,Ronning C.M.,Koo H.L.,Moffat K.S.,Cronin L.A.,Shen M.,Pai G.,Van Aken S.,Umayam L.,Tallon L.J.,Gill J.E.,Adams M.D.,Carrera A.J.,Creasy T.H.,Goodman H.M.,Somerville C.R.,Copenhaver G.P.,Preuss D.,Nierman W.C.,White O.,Eisen J.A.,Salzberg S.L.,Fraser C.M.,Venter J.C.
Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana.
Nature
402
761-768
1999
438946
Cheng C.Y.,Krishnakumar V.,Chan A.P.,Thibaud-Nissen F.,Schobel S.,Town C.D.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Plant J.
89
789-804
2017
438948
Velasquez S.M.,Ricardi M.M.,Dorosz J.G.,Fernandez P.V.,Nadra A.D.,Pol-Fachin L.,Egelund J.,Gille S.,Harholt J.,Ciancia M.,Verli H.,Pauly M.,Bacic A.,Olsen C.E.,Ulvskov P.,Petersen B.L.,Somerville C.,Iusem N.D.,Estevez J.M.
O-glycosylated cell wall proteins are essential in root hair growth.
Science
332
1401-1403
2011