Sequence of B1XMM6_SYNP2

EC Number:1.2.1.79

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
succinate-semialdehyde dehydrogenase (NADP+)
B1XMM6
Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
454
49019
Reaction
succinate semialdehyde + NADP+ + H2O = succinate + NADPH + 2 H+
Other sequences found for EC No. 1.2.1.79

General information:

Sequence
show sequence in normal format
>|succinate-semialdehyde dehydrogenase (NADP+)|EC 1.2.1.79||
MAIATINPTTGEICQRFKALTPAEIDAKLAKAQEAFQAYRRTSFSQRRQWLENAAAILER
DTSKFAEIMTTEMGKTHQSAIAEAEKSALVCRYYAEHGEQFLANEYTETQATESYVCYQP
LGILLAVMPWNFPFWQVFRFAAPALMAGNVAVLKHASNVPQCALAVEAILEAAGFPEGVF
QTLLIGASQVEQVIKDPRVKAATLTGSEPAGASLASLAGQEIKPTLLELGGSDPFVVFPS
ADLDEAVEVGTVARTMNNGQSCIAAKRFILHEAIAAEFLEKLHLKFASLKIGDPMAPETD
IGPLATEGILQDISRQVDQAVAAGAKILLGGRPLDRAGYFYPPTILTEIPPGAKILQEEL
FAPVAMVFTVKDLDQAIALANDIPFGLGASAWTNDPAEQQRFIQELDAGAVFINGMVKSD
PRLPFGGTKRSGYGRELGLAGIRTFVNAKTVWLK
Download this sequence
in fasta format
Download all sequences for 1.2.1.79
in fasta format
in csv (Excel, OpenOffice) format