Sequence of A0A5H9PXM0_SALET

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
lactaldehyde reductase
A0A5H9PXM0
Salmonella enterica subsp. enterica serovar Nima
382
40520
Reaction
(R)[or (S)]-propane-1,2-diol + NAD+ = (R)[or (S)]-lactaldehyde + NADH + H+
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A5H9PXM0|lactaldehyde reductase|EC 1.1.1.77|Salmonella enterica subsp. enterica serovar Nima|TrEMBL
MANRMILNETAWFGRGAVDALTDEVTRRGYHKALIVTDKTLVQCGVVDKVTSRMDAAGLA
WEIYAGVIPNPTISVVQEGLKVFTQSGADYLIAIGGGSPQDTCKAIGIISNNPEFADVRS
LEGLSPTRKPSVPIMAIPTTAGTAAEVTINYVITDEEKRRKFVCVDPHDIPQAAFIDADM
MDGMPPALKAATGVDALTHAIEGYITRAAWALTDALHIKAIEIIAGALRGAVAGEKEAGE
AMALGQYVAGMGFSNVGLGLVHGMAHPLGAFYNTPHGVANAILLPHVMRFNAGSTNEKFR
DIARAMGVKVEGLSLEEARNAAVEAVFALNRDVGIPLHLRDVGVRKEDIPALAQAAFDDV
CTGGNPREASLADIVELYHIAW
Download this sequence
in fasta format
Download all sequences for 1.1.1.77
in fasta format
in csv (Excel, OpenOffice) format