Sequence of A0A061M1M5_BIFLN

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
galactan 1,3-beta-galactosidase
A0A061M1M5
Bifidobacterium longum subsp. longum
1278
134674
Reaction
hydrolysis of terminal, non-reducing beta-D-galactose residues in (1->3)-beta-D-galactopyranans
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A061M1M5|galactan 1,3-beta-galactosidase|EC 3.2.1.145|Bifidobacterium longum subsp. longum|TrEMBL
MKINNKGKGALIAAITAAATLLSCGLAAASASAAGVDYLPTIGQVPTYTKFQPTADPGKN
ASDYFQPYWYAKNANDNGGTHIQAHGGQVVKVGDAYYWYGEDRSNGYDNSPGVHAYMSTD
LYNWTDLGVALRAVTSKSQLTDKSNADYAYFDKAYNLTKSDGSVDAAKADAIFPYLNTNP
DQDGDGAVDSVQGIFERPKIIYNKKNKQYVLWWHSDGSTTPGGSNYARALAGVAVSDNPA
GPFTMVGAYRLPNQNNWKEAAGNPSWGENGDSRDMTVFVDPKDDSAYVLYSSEANATLYI
AKLNDDYTNVVKTTNVDQSEGQKQYSADGQYPYILADATTDAPVRGEDFQIVKQNGSLEA
PAVFQYDGRYNIIASGATGWAPNKQTYYTADSMLGNWTRGVEKDDVNENTWYNNMPEGAD
GLLSVGDTRGTTFGSQSASVLAVDQEKGHFIYLGDRWDSGKADSTYVWLPLTIGENGTIE
MHNPAQEGEPDGWDLSYWGNHGSAKGKLVNWTVETGDDLPKTVNTGGTVTLPDTVNVKEG
DDTIATKVTWNVEGGTAVSKSTKAAGNTYAFNVPGAYTITGTLAESSNFNPGRTFRRTID
VSCSNPISGSWKEAHWKGGSACQVSASGGAYDFTITDNANRGVWTDRNEGSAVYQPDALD
VNETLETTVKPLDLGGNGDPRAGLVVRNGLADANGGKGYATLLASLSGVYMQYDSNADGY
IDKETSHVGTGFGDQVQLKLERISTDTLKGYWRASANDEWQDVATVTLTGADVTGLDAGA
FATSNSNAGAFTVAFNGTAFGSQTAAVESIAAKGPETTIAKRQTLAHKDVTVTATLTNGK
TRVLEPDEYTLEGFDTTKLGEQTVTVRLVTDSSVTATLTVTVESNLARLFCSSAAASKYE
PASSWASASTADLTCDNNLSTNWSNWGTGDTSPWLSYTFDKAYQLGKLSVAVDKAKGEAA
PKSFTVSYLAEDNATWTDATLPAVTVNGAAGAVTEADVSALPATKGIRLNFTYADGNDYA
KIAEVRIAEGEATPEPQPSSNANLADLTVDGKTVDGFSADITEYAGALAGDAASYPTVEA
TAADAKATVQVEQASTENSGVATVTVTAEDGTAETYTVTFGELPQLAELAVEVTKDSYQV
GDKFNAADVKVSAIYKVGDTETLRKLIDPTDGDLKFTGFDSATAGTKTITVSYRGVNATF
EVTVTATEVTPGPGEQKPGDTNNPGNTAKPGNTATNEPAANGAAPLSNTGAAVAAIAVVV
VALAAAAGALLVIRKRRA
Download this sequence
in fasta format
Download all sequences for 3.2.1.145
in fasta format
in csv (Excel, OpenOffice) format