Sequence of HGD_BURCA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
homogentisate 1,2-dioxygenase
Q1BYQ6
Burkholderia cenocepacia (strain AU 1054)
444
48960
Reaction
homogentisate + O2 = 4-maleylacetoacetate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q1BYQ6|homogentisate 1,2-dioxygenase|EC 1.13.11.5|Burkholderia cenocepacia (strain AU 1054)|Swiss-Prot
MTLDLSKPATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGH
NRRSWLYRIRPAAVHRPFEPYAGAQRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFV
DGLVTMAGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLD
VEPFEIAVIPRGVRFAVALPDGNARGYICENFGALLRLPDLGPIGSNGLANPRDFLTPQA
AYEDREGAFELIAKLNGRLWRADIGHSPLDVVAWHGNYAPYKYDLRLFNTIGSISFDHPD
PSIFLVLQAQSDTPGVDTIDFVIFPPRWLAAEDTFRPPWFHRNVASEFMGLVHGAYDAKA
EGFVPGGASLHNCMSGHGPDADTFEKASASDTTKPHKVDATMAFMFETRTLIRPTRYALD
TAQLQADYFECWQGIKKHFNPEQR
Download this sequence
in fasta format
Download all sequences for 1.13.11.5
in fasta format
in csv (Excel, OpenOffice) format