Sequence of PTC_LACSS

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
putrescine carbamoyltransferase
Q38ZL1
Lactobacillus sakei subsp. sakei (strain 23K)
343
38032
Reaction
carbamoyl phosphate + putrescine = phosphate + N-carbamoylputrescine
Sequences with same EC No.
Sequence
show sequence in normal format
>Q38ZL1|putrescine carbamoyltransferase|EC 2.1.3.6|Lactobacillus sakei subsp. sakei (strain 23K)|Swiss-Prot
MKRDFIDTKDYTQAEIQYLIDLGLQIKKDIKAGDYPQLLSNRTLGMLFEESSTRTRVSFE
TAMTQLGGHAQYLAPGQIHLGSAESESLGDTAIVLSRLVDILMARVATHDTIETIANAAT
VPVLNGMTDYNHPTQEIGDIITMAEHLPAGKKLSDCKVVFVGDATQVCVSLMFVATKMGM
QFVQYGPKGYQIKPETLAIGQKNAEVSGGSVLITEDTDQAMRDADFVYTDVWYGLYESPL
SYDERMAIFYPKYQVNDELMAKAAKHAKFMHCLPANRGEEVTDSVLDSDASVAWDEAENR
LTAMRALLVYLMAPIIDYSDDTLNNLKDPALKDLLNNRIDSTK
Download this sequence
in fasta format
Download all sequences for 2.1.3.6
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
941103
Chaillou S.,Champomier-Verges M.-C.,Cornet M.,Crutz-Le Coq A.-M.,Dudez A.-M.,Martin V.,Beaufils S.,Darbon-Rongere E.,Bossy R.,Loux V.,Zagorec M.
The complete genome sequence of the meat-borne lactic acid bacterium Lactobacillus sakei 23K.
Nat. Biotechnol.
23
1527-1533
2005