Sequence of KGP2_MOUSE

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
cGMP-dependent protein kinase
Q61410
Mus musculus
762
87085
Reaction
ATP + a protein = ADP + a phosphoprotein
Sequences with same EC No.
Sequence
show sequence in normal format
>Q61410|cGMP-dependent protein kinase|EC 2.7.11.12|Mus musculus|Swiss-Prot
MGNGSVKPKHAKHPDGHSGNLSNEALRSKVLELERELRRKDAELQEREYHLKELREQLAK
QTVAIAELTEELQSKCIQLNKLQDVIHVQGGSPLQASPDKVPLDVHRKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGEKLSTGSYVIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISDDVRSANIIAEENDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRHAKRS
MSSWKLSKALSLEMIQLKEKVARFSSTSPFQNLEIIATLGVGGFGRVELVKVKNENVAFA
MKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDRGSFDEPTSKFCVACVTEAFDYLHLLGIIYRDLKPENLILDADGYLKLVDFGFAKK
IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYN
LILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLK
ARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKDF
Download this sequence
in fasta format
Download all sequences for 2.7.11.12
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
667615
Uhler M.D.
Cloning and expression of a novel cyclic GMP-dependent protein kinase from mouse brain.
J. Biol. Chem.
268
13586-13591
1993
667616
Pfeifer A.,Aszodi A.,Seidler U.,Ruth P.,Hofmann F.,Faessler R.
Intestinal secretory defects and dwarfism in mice lacking cGMP-dependent protein kinase II.
Science
274
2082-2086
1996
667617
Rangaswami H.,Marathe N.,Zhuang S.,Chen Y.,Yeh J.C.,Frangos J.A.,Boss G.R.,Pilz R.B.
Type II cGMP-dependent protein kinase mediates osteoblast mechanotransduction.
J. Biol. Chem.
284
14796-14808
2009
667618
Huttlin E.L.,Jedrychowski M.P.,Elias J.E.,Goswami T.,Rad R.,Beausoleil S.A.,Villen J.,Haas W.,Sowa M.E.,Gygi S.P.
A tissue-specific atlas of mouse protein phosphorylation and expression.
Cell
143
1174-1189
2010