Sequence of AGK_PONAB

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
acylglycerol kinase
Q5RED7
Pongo abelii
422
47068
Reaction
ATP + acylglycerol = ADP + acyl-sn-glycerol 3-phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q5RED7|acylglycerol kinase|EC 2.7.1.94|Pongo abelii|Swiss-Prot
MTVFFKTLRNHWKKTTAGLCLLTWGGHWLYGKHCDNLLRRAACQEAQVFGNQLIPPNAQV
KKATVFLNPAACKGKARTLFEKNAAPILHLCGMDVTIVKTDYEGQAKKLLELMENTDVII
VAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGETSSLSHTLFAESGNKVQHITDATL
AIVKGETVPLDVLQIKGEKEQPVFAMTGLRWGSFRDAGVKVSKYWYLGPLKIKAAHFFST
LKEWPQTHQASISYTGPTERPPSEPEETPVQRPSLYRRILRRLASYWAQPQDALSQEVSP
EVWKDVQLSTIELSITTRNNQLDPTSKEDFLNICIEPDTISKGDFITIGSRKVRNPKLHA
EGTECLQASQCTLLIPEGAGGSFSIDSEEYEAMPVEVKLLPRKLQFFCDPRKREQMLTSP
AQ
Download this sequence
in fasta format
Download all sequences for 2.7.1.94
in fasta format
in csv (Excel, OpenOffice) format