Any feedback?
Please rate this page
(search_result.php)
(0/150)

BRENDA support

Refine search

Search Substrates and Products (Substrate)

show results
Don't show organism specific information (fast!)
Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)
(Not possible to combine with the first option)
Refine your search

Search term:

Results 1 - 10 of 47 > >>
EC Number Substrates Commentary Substrates Organism Products Commentary (Products) Reversibility
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.2Ac-Phe-Tyr radio-labeled substrate Sus scrofa Ac-Phe + Tyr - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.2acetyl-Phe-L-diiodotyrosine + H2O - Sus scrofa acetyl-L-phenylalanine + L-diiodotyrosine - ir
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.2casein + H2O - Sus scrofa ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.2FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O oxidized insulin B chain, cleavage site specificity determination Sus scrofa FVNQHLCGSHL + VEA + Leu + Tyr + LVCGERGF + Phe + YTPKA - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.2Gelatin + H2O - Sus scrofa ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.2Gelatin + H2O - Canis lupus familiaris ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.2Gelatin + H2O liquefication Sus scrofa ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.2gelatin + H2O - Sus scrofa ? + ? - ir
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.2Hemoglobin + H2O - Sus scrofa ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.2Hemoglobin + H2O - Boreogadus saida ? - ?
Results 1 - 10 of 47 > >>