Literature summary for 3.4.23.5 extracted from

Baechle, D.; Flad, T.; Cansier, A.; Steffen, H.; Schittek, B.; Tolson, J.; Herrmann, T.; Dihazi, H.; Beck, A.; Mueller, G.A.; Mueller, M.; Stevanovic, S.; Garbe, C.; Mueller, C.A.; Kalbacher, H.
Cathepsin D is present in human eccrine sweat and involved in the postsecretory processing of the antimicrobial peptide DCD-1L (2006), J. Biol. Chem., 281, 5406-5415.

Search for more literature for 3.4.23.5

Application

Application	Comment	Organism
medicine	cathepsin D is involved in the postsecretory processing of the antimicrobial peptide DCD-1L in human sweat	Homo sapiens

Inhibitors

Inhibitors	Comment	Organism	Structure
additional information	no inhibition by iodoacetamide and E64 (inhibitors for cysteine proteases), leupeptin, and phenylmethanesulfonyl fluoride (inhibitors for serine proteases) or EDTA and 1,10-phenanthroline (inhibitors for metalloproteases)	Homo sapiens
pepstatin A	-	Homo sapiens

Molecular Weight [Da]

Molecular Weight [Da]	Molecular Weight Maximum [Da]	Comment	Organism
31000	-	active beta-chain of CatD	Homo sapiens
56000	-	proform of CatD	Homo sapiens

Organism

Organism	UniProt	Comment	Textmining
Homo sapiens	-	-	-

Source Tissue

Source Tissue	Comment	Organism	Textmining
sweat	CatD is expressed in human eccrine sweat. Both forms, the active beta-chain of CatD (31 kDa) as well as the proform (56 kDa) can be detected in eccrine sweat, the latter in lower amounts	Homo sapiens	-

Specific Activity [micromol/min/mg]

Specific Activity Minimum [µmol/min/mg]	Specific Activity Maximum [µmol/min/mg]	Comment	Organism
additional information	-	CatD is active in human sweat	Homo sapiens

Substrates and Products (Substrate)

Substrates	Comment Substrates	Organism	Products	Comment (Products)	Rev.	Reac.
Amca-EEKPISFFRLGK + H2O	CatD cleaves the substrate Amca-EEKPISFFRLGK specifically between the two phenylalanine residues yielding the two peptides Amca-EEKPISF and FRLGK. Only the first peptide can be detected using fluorescence detection	Homo sapiens	Amca-EEKPISF + FRLGK	-	?
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES + H2O	LL-37, peptide present in human sweat. Only weak cleavage is seen between Phe5 and Phe6 yielding FRK-32 and between Phe27 and Leu28 yielding LRN-10 and LLG-27	Homo sapiens	LLGDF + FRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES	-	?
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES + H2O	LL-37, peptide present in human sweat. Only weak cleavage is seen between Phe5 and Phe6 yielding FRK-32 and between Phe27 and Leu28 yielding LRN-10 and LLG-27	Homo sapiens	LLGDFFRKSKEKIGKEFKRIVQRIKDF + LRNLVPRTES	-	?
SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL + H2O	DCD-1L, peptide present in human sweat. DCD-1L is cleaved by CatD dominantly between Leu44 and Asp45 yielding SSL-44 and the tetrapeptide DSVL and to a lower amount between Leu29 and Glu30 leading to the peptide SSL-29 and corresponding peptides ESV-19 and ESV-15, respectively. These cleavage sites agree well with the specificity of CatD, which preferably cleaves proteins and peptides with leucine or an aromatic amino acid residue in the P1 position	Homo sapiens	SSLLEKGLDGAKKAVGGLGKLGKDAVEDL + ESVGKGAVHDVKDVLDSVL	-	?
SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL + H2O	DCD-1L, peptide present in human sweat. DCD-1L is cleaved by CatD dominantly between Leu44 and Asp45 yielding SSL-44 and the tetrapeptide DSVL and to a lower amount between Leu29 and Glu30 leading to the peptide SSL-29 and corresponding peptides ESV-19 and ESV-15, respectively. These cleavage sites agree well with the specificity of CatD, which preferably cleaves proteins and peptides with leucine or an aromatic amino acid residue in the P1 position	Homo sapiens	SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVL + DSVL	-	?

Synonyms

Synonyms	Comment	Organism
CatD	-	Homo sapiens
cathepsin D	-	Homo sapiens

Temperature Optimum [°C]

Temperature Optimum [°C]	Temperature Optimum Maximum [°C]	Comment	Organism
37	-	assay at	Homo sapiens

pH Optimum

pH Optimum Minimum	pH Optimum Maximum	Comment	Organism
3.5	-	assay at	Homo sapiens

Use of this online version of BRENDA is free under the CC BY 4.0 license. See terms of use for full details.

Release 2023.1 (January 2023)