Cloned (Comment) | Organism |
---|---|
expression of procathepsin X in Pichia pastoris as an alpha-factor fusion | Homo sapiens |
Natural Substrates | Organism | Comment (Nat. Sub.) | Natural Products | Comment (Nat. Pro.) | Rev. | Reac. |
---|---|---|---|---|---|---|
alpha-enolase + H2O | Homo sapiens | cathepsin X cleaves the C-terminal dipeptide of alpha- and gamma-enolase abolishing their neurotrophic activity | ? | - |
? | |
gamma-enolase + H2O | Homo sapiens | cathepsin X cleaves the C-terminal dipeptide of alpha- and gamma-enolase abolishing their neurotrophic activity | ? | - |
? | |
additional information | Homo sapiens | co-localization of alpha or gamma enolase and cathepsin X. Cathepsin X impairs survival and neuritogenesis of neuronal cells, e.g. it reduces PC12 cell survival and neuritogenesis | ? | - |
? |
Organism | UniProt | Comment | Textmining |
---|---|---|---|
Homo sapiens | - |
- |
- |
Posttranslational Modification | Comment | Organism |
---|---|---|
proteolytic modification | procathepsin X has to be activated | Homo sapiens |
Source Tissue | Comment | Organism | Textmining |
---|---|---|---|
KG-1 cell | a human myeloblast cell line, derived from bone marrow aspirate obtained from male with erythroleukemia that evolved into acute myelogenous leukemia. KG-1 cells differentiate to macrophage like cells, express significant amount of cathepsin X | Homo sapiens | - |
neuron | - |
Homo sapiens | - |
Substrates | Comment Substrates | Organism | Products | Comment (Products) | Rev. | Reac. |
---|---|---|---|---|---|---|
AKYNQLMRIEEELGEEARFAGHNFRNPSVL + H2O | a model peptide derived from rat gamma-enolase carboxyl terminal, overview | Homo sapiens | ? | - |
? | |
alpha-enolase + H2O | cathepsin X cleaves the C-terminal dipeptide of alpha- and gamma-enolase abolishing their neurotrophic activity | Homo sapiens | ? | - |
? | |
alpha-enolase + H2O | cathepsin X cleaves the C-terminal dipeptide | Homo sapiens | ? | - |
? | |
gamma-enolase + H2O | cathepsin X cleaves the C-terminal dipeptide of alpha- and gamma-enolase abolishing their neurotrophic activity | Homo sapiens | ? | - |
? | |
gamma-enolase + H2O | cathepsin X cleaves the C-terminal dipeptide | Homo sapiens | ? | - |
? | |
KAKFAGRNPRNPLAK + H2O | a model peptide derived from human alpha-enolase carboxyl terminal, overview | Homo sapiens | ? | - |
? | |
additional information | co-localization of alpha or gamma enolase and cathepsin X. Cathepsin X impairs survival and neuritogenesis of neuronal cells, e.g. it reduces PC12 cell survival and neuritogenesis | Homo sapiens | ? | - |
? |
pH Optimum Minimum | pH Optimum Maximum | Comment | Organism |
---|---|---|---|
5.5 | - |
assay at | Homo sapiens |