Crystallization (Comment) | Organism |
---|---|
purified isozymes Ia and Ib from acetone | Trametes coccinea |
Localization | Comment | Organism | GeneOntology No. | Textmining |
---|---|---|---|---|
extracellular | the isozymes are secreted | Trametes coccinea | - |
- |
Molecular Weight [Da] | Molecular Weight Maximum [Da] | Comment | Organism |
---|---|---|---|
33000 | 34000 | sedimentation equilibrium centrifugation analysis | Trametes coccinea |
Natural Substrates | Organism | Comment (Nat. Sub.) | Natural Products | Comment (Nat. Pro.) | Rev. | Reac. |
---|---|---|---|---|---|---|
additional information | Trametes coccinea | the extracellular enzyme is involved in fungal nutrition from wood | ? | - |
? |
Organism | UniProt | Comment | Textmining |
---|---|---|---|
Trametes coccinea | - |
a wood-deteriorating basidiomycete, formerly Trametes sanguinea, isozymes Ia and Ib | - |
Purification (Comment) | Organism |
---|---|
native isozymes Ia and Ib 30fold to homogeneity from mycel-free culture filtrate, by acetone precipitation, anion exchange chromatograph, ammonium sulfate fractionation, dialysis and crystallization to homogeneity, and further to puritiy by anion exchange and sulfopropyl chromatograpgy, and isoelectric focusing | Trametes coccinea |
Source Tissue | Comment | Organism | Textmining |
---|---|---|---|
commercial preparation | crude enzyme preparation | Trametes coccinea | - |
mycelium | submerged culture | Trametes coccinea | - |
Specific Activity Minimum [µmol/min/mg] | Specific Activity Maximum [µmol/min/mg] | Comment | Organism |
---|---|---|---|
additional information | - |
purified isozyme Ia and Ib | Trametes coccinea |
Substrates | Comment Substrates | Organism | Products | Comment (Products) | Rev. | Reac. |
---|---|---|---|---|---|---|
angiotensin + H2O | cleavage at Tyr4-Ile5, at pH 2.7 | Trametes coccinea | ? | - |
? | |
casein + H2O | - |
Trametes coccinea | ? | - |
? | |
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O | i.e. oxidized insulin B chain, cleavage site specificity of isozymes Ia and Ib at pH 2.7, overview | Trametes coccinea | FVNQHLCGSHLVEA + Leu-Val + LVCGERGF + FYTPKA | - |
? | |
Hemoglobin + H2O | - |
Trametes coccinea | ? | - |
? | |
additional information | the extracellular enzyme is involved in fungal nutrition from wood | Trametes coccinea | ? | - |
? | |
additional information | cleavage site specificity of the isoymes, no activity with isulin A chain, overview | Trametes coccinea | ? | - |
? | |
pro-angiotensin + H2O | cleavage at Tyr4-Ile5 and Phe8-Phe9, at pH 2.7 | Trametes coccinea | ? | - |
? |
Subunits | Comment | Organism |
---|---|---|
More | three-dimensional structure and active site structure | Trametes coccinea |
Synonyms | Comment | Organism |
---|---|---|
carboxyl proteinase I | formerly | Trametes coccinea |
pH Optimum Minimum | pH Optimum Maximum | Comment | Organism |
---|---|---|---|
2.3 | - |
substrate hemoglobin | Trametes coccinea |
2.5 | - |
substrate casein | Trametes coccinea |
Organism | Comment | pI Value Maximum | pI Value |
---|---|---|---|
Trametes coccinea | isozyme Ib | - |
4.6 |
Trametes coccinea | isozyme Ia | - |
4.7 |