Any feedback?
Literature summary for 3.4.23.30 extracted from
- Pycnoporopepsin (2004), Handbook of Proteolytic Enzymes (Barrett, J. ; Rawlings, N. D. ; Woessner, J. F. , eds. ), 1, 141-143.
No PubMed abstract available
Crystallization (Commentary)
| Crystallization (Comment) | Organism |
|---|---|
| purified isozymes Ia and Ib from acetone | Trametes coccinea |
Localization
| Localization | Comment | Organism | GeneOntology No. | Textmining |
|---|---|---|---|---|
| extracellular | the isozymes are secreted | Trametes coccinea | - |
- |
Molecular Weight [Da]
| Molecular Weight [Da] | Molecular Weight Maximum [Da] | Comment | Organism |
|---|---|---|---|
| 33000 | 34000 | sedimentation equilibrium centrifugation analysis | Trametes coccinea |
Natural Substrates/ Products (Substrates)
| Natural Substrates | Organism | Comment (Nat. Sub.) | Natural Products | Comment (Nat. Pro.) | Rev. | Reac. |
|---|---|---|---|---|---|---|
| additional information | Trametes coccinea | the extracellular enzyme is involved in fungal nutrition from wood | ? | - |
? |  |
Organism
| Organism | UniProt | Comment | Textmining |
|---|---|---|---|
| Trametes coccinea | - |
a wood-deteriorating basidiomycete, formerly Trametes sanguinea, isozymes Ia and Ib | - |
Purification (Commentary)
| Purification (Comment) | Organism |
|---|---|
| native isozymes Ia and Ib 30fold to homogeneity from mycel-free culture filtrate, by acetone precipitation, anion exchange chromatograph, ammonium sulfate fractionation, dialysis and crystallization to homogeneity, and further to puritiy by anion exchange and sulfopropyl chromatograpgy, and isoelectric focusing | Trametes coccinea |
Source Tissue
| Source Tissue | Comment | Organism | Textmining |
|---|---|---|---|
| commercial preparation | crude enzyme preparation | Trametes coccinea | - |
| mycelium | submerged culture | Trametes coccinea | - |
Specific Activity [micromol/min/mg]
| Specific Activity Minimum [µmol/min/mg] | Specific Activity Maximum [µmol/min/mg] | Comment | Organism |
|---|---|---|---|
| additional information | - |
purified isozyme Ia and Ib | Trametes coccinea |
Substrates and Products (Substrate)
| Substrates | Comment Substrates | Organism | Products | Comment (Products) | Rev. | Reac. |
|---|---|---|---|---|---|---|
| angiotensin + H2O | cleavage at Tyr4-Ile5, at pH 2.7 | Trametes coccinea | ? | - |
? | |
| casein + H2O | - |
Trametes coccinea | ? | - |
? | |
| FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O | i.e. oxidized insulin B chain, cleavage site specificity of isozymes Ia and Ib at pH 2.7, overview | Trametes coccinea | FVNQHLCGSHLVEA + Leu-Val + LVCGERGF + FYTPKA | - |
? | |
| Hemoglobin + H2O | - |
Trametes coccinea | ? | - |
? | |
| additional information | the extracellular enzyme is involved in fungal nutrition from wood | Trametes coccinea | ? | - |
? | |
| additional information | cleavage site specificity of the isoymes, no activity with isulin A chain, overview | Trametes coccinea | ? | - |
? | |
| pro-angiotensin + H2O | cleavage at Tyr4-Ile5 and Phe8-Phe9, at pH 2.7 | Trametes coccinea | ? | - |
? | |
Subunits
| Subunits | Comment | Organism |
|---|---|---|
| More | three-dimensional structure and active site structure | Trametes coccinea |
Synonyms
| Synonyms | Comment | Organism |
|---|---|---|
| carboxyl proteinase I | formerly | Trametes coccinea |
pH Optimum
| pH Optimum Minimum | pH Optimum Maximum | Comment | Organism |
|---|---|---|---|
| 2.3 | - |
substrate hemoglobin | Trametes coccinea |
| 2.5 | - |
substrate casein | Trametes coccinea |
pI Value
| Organism | Comment | pI Value Maximum | pI Value |
|---|---|---|---|
| Trametes coccinea | isozyme Ib | - |
4.6 |
| Trametes coccinea | isozyme Ia | - |
4.7 |
Use of this online version of BRENDA is free under the CC BY 4.0 license. See terms of use for full details.
Release 2023.1 (January 2023)
Legal
Curated at
Member of
