Information on EC 3.4.23.30 - Pycnoporopepsin

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Specify your search results
Select one or more organisms in this record:
Show additional data
Do not include text mining results
Include (text mining) results (more...)
Include results (AMENDA + additional results, but less precise; more...)

The enzyme appears in viruses and cellular organisms

EC NUMBER
COMMENTARY hide
3.4.23.30
-
RECOMMENDED NAME
GeneOntology No.
Pycnoporopepsin
-
REACTION
REACTION DIAGRAM
COMMENTARY hide
ORGANISM
UNIPROT
LITERATURE
Similar to pepsin A, but narrower, cleaving only three bonds in the B chain of insulin: Ala14-/-Leu, Tyr16-/-Leu, and Phe24-/-Phe
show the reaction diagram
-
-
-
-
REACTION TYPE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
hydrolysis of peptide bond
-
-
aspartic endopeptidase
-
CAS REGISTRY NUMBER
COMMENTARY hide
77967-78-3
-
ORGANISM
COMMENTARY hide
LITERATURE
UNIPROT
SEQUENCE DB
SOURCE
a wood-deteriorating basidiomycete, formerly Trametes sanguinea, isozymes Ia and Ib
-
-
Manually annotated by BRENDA team
i.e. Pycnoporus coccineus, Trametes sanguinea
-
-
Manually annotated by BRENDA team
SUBSTRATE
PRODUCT                       
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
Reversibility
r=reversible
ir=irreversible
?=not specified
Angiotensin + H2O
?
show the reaction diagram
Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser + H2O
Asp-Arg-Val-Tyr + Ile-His-Pro-Phe-His-Leu-Leu + Val-Tyr-Ser
show the reaction diagram
-
cleavage of Tyr-Ile and Leu-Val
-
-
-
casein + H2O
?
show the reaction diagram
-
-
-
-
?
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O
FVNQHLCGSHLVEA + Leu-Val + LVCGERGF + FYTPKA
show the reaction diagram
-
i.e. oxidized insulin B chain, cleavage site specificity of isozymes Ia and Ib at pH 2.7, overview
-
-
?
Hemoglobin + H2O
?
show the reaction diagram
-
-
-
-
?
Native insulin + H2O
Hydrolyzed insulin
show the reaction diagram
-
Ala14-Leu15, Tyr16-Leu17 and Phe24-Phe25 bonds are hydrolyzed
-
-
Oxidized B-chain of insulin + H2O
Hydrolyzed insulin B-chain
show the reaction diagram
-
Ala14-Leu15, Tyr16-Leu17 and Phe24-Phe25 bonds are hydrolyzed primarily
-
-
Oxidized insulin peptide B1-B16 + H2O
?
show the reaction diagram
-
hydrolysis at His10-Leu11 and Ala14-Leu15
-
-
-
pro-angiotensin + H2O
?
show the reaction diagram
-
cleavage at Tyr4-Ile5 and Phe8-Phe9, at pH 2.7
-
-
?
Proangiotensin + H2O
?
show the reaction diagram
-
formerly designated angiotensin I, hydrolysis of Tyr4-Ile5
-
-
-
additional information
?
-
NATURAL SUBSTRATES
NATURAL PRODUCTS
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
REVERSIBILITY
r=reversible
ir=irreversible
?=not specified
additional information
?
-
-
the extracellular enzyme is involved in fungal nutrition from wood
-
-
-
SPECIFIC ACTIVITY [µmol/min/mg]
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
additional information
-
purified isozyme Ia and Ib
pH OPTIMUM
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
2.3
-
substrate hemoglobin
2.5
-
substrate casein
pI VALUE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
4.6
-
isozyme Ib
4.7
-
isozyme Ia
SOURCE TISSUE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
SOURCE
-
crude enzyme preparation
Manually annotated by BRENDA team
-
submerged culture
Manually annotated by BRENDA team
LOCALIZATION
ORGANISM
UNIPROT
COMMENTARY hide
GeneOntology No.
LITERATURE
SOURCE
-
the isozymes are secreted
-
Manually annotated by BRENDA team
MOLECULAR WEIGHT
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
33000 - 34000
-
sedimentation equilibrium centrifugation analysis
SUBUNITS
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
additional information
-
three-dimensional structure and active site structure
Crystallization/COMMENTARY
ORGANISM
UNIPROT
LITERATURE
purified isozymes Ia and Ib from acetone
-
Purification/COMMENTARY
ORGANISM
UNIPROT
LITERATURE
i.e. Pycnoporus coccineus, Trametes sanguinea
-
native isozymes Ia and Ib 30fold to homogeneity from mycel-free culture filtrate, by acetone precipitation, anion exchange chromatograph, ammonium sulfate fractionation, dialysis and crystallization to homogeneity, and further to puritiy by anion exchange and sulfopropyl chromatograpgy, and isoelectric focusing
-