Natural Substrates | Organism | Comment (Nat. Sub.) | Natural Products | Comment (Nat. Pro.) | Rev. | Reac. |
---|---|---|---|---|---|---|
additional information | Sus scrofa | catalyzes the NH2-terminal hydrolysis of N-acylpeptides to release N-acylated amino acids | ? | - |
? |
Organism | UniProt | Comment | Textmining |
---|---|---|---|
Sus scrofa | - |
- |
- |
Substrates | Comment Substrates | Organism | Products | Comment (Products) | Rev. | Reac. |
---|---|---|---|---|---|---|
Asp-Ala-p-nitroanilide + H2O | - |
Sus scrofa | ? | - |
? | |
Asp-Pro-p-nitroanilide + H2O | - |
Sus scrofa | ? | - |
? | |
isoAsp-Ala-p-nitroanilide + H2O | - |
Sus scrofa | ? | - |
? | |
isoD/DAEFRHDSGYEVHHQKLVFFAEDVGSNKGA-NH2 + H2O | - |
Sus scrofa | ? | - |
? | |
additional information | catalyzes the NH2-terminal hydrolysis of N-acylpeptides to release N-acylated amino acids | Sus scrofa | ? | - |
? |
Synonyms | Comment | Organism |
---|---|---|
AARE | - |
Sus scrofa |
acylamino acid-releasing enzyme | - |
Sus scrofa |
Temperature Optimum [°C] | Temperature Optimum Maximum [°C] | Comment | Organism |
---|---|---|---|
30 | - |
activity assay | Sus scrofa |
pH Optimum Minimum | pH Optimum Maximum | Comment | Organism |
---|---|---|---|
7.2 | - |
activity assay | Sus scrofa |