Information on EC 3.4.19.1 - acylaminoacyl-peptidase

New: Word Map on EC 3.4.19.1
Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Specify your search results
Mark a special word or phrase in this record:
Search Reference ID:
Select one or more organisms in this record:
Show additional data
Do not include text mining results
Include (text mining) results (more...)
Include results (AMENDA + additional results, but less precise; more...)


The expected taxonomic range for this enzyme is: Archaea, Eukaryota, Bacteria

EC NUMBER
COMMENTARY hide
3.4.19.1
-
RECOMMENDED NAME
GeneOntology No.
acylaminoacyl-peptidase
REACTION
REACTION DIAGRAM
COMMENTARY hide
ORGANISM
UNIPROT
LITERATURE
cleavage of an N-acetyl or N-formyl amino acid from the N-terminus of a polypeptide
show the reaction diagram
-
-
-
-
REACTION TYPE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
hydrolysis of peptide bond
CAS REGISTRY NUMBER
COMMENTARY hide
73562-30-8
-
ORGANISM
COMMENTARY hide
LITERATURE
UNIPROT
SEQUENCE DB
SOURCE
Aeropyrum pernix DSM 11879
-
Uniprot
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
L. suyo
-
-
Manually annotated by BRENDA team
B
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
-
UniProt
Manually annotated by BRENDA team
strain JCM4673
-
-
Manually annotated by BRENDA team
strain JCM4673
-
-
Manually annotated by BRENDA team
-
SwissProt
Manually annotated by BRENDA team
-
SwissProt
Manually annotated by BRENDA team
synthetic construct
-
-
-
Manually annotated by BRENDA team
GENERAL INFORMATION
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
malfunction
physiological function
SUBSTRATE
PRODUCT                       
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
Reversibility
r=reversible
ir=irreversible
?=not specified
2-aminobenzoyl-Ala-Leu-Phe-Gln-Gly-Pro-Phe(NO2)-Ala + H2O
2-aminobenzoyl-Ala-Leu-Phe + Gln-Gly-Pro-Phe(NO2)-Ala
show the reaction diagram
2-aminobenzoyl-EALFQGPF(NO2)A + H2O
?
show the reaction diagram
very good substrate
-
-
?
2-aminobenzoyl-EFSPF(NO2)RA + H2O
?
show the reaction diagram
-
-
-
?
2-aminobenzoyl-GFEPF(NO2)RA + H2O
?
show the reaction diagram
good substrate, displays greater kinetic specificity than acetyl-Phe-2-naphthylamide
-
-
?
2-aminobenzoyl-KARVLF(NO2)EA-Nle + H2O
?
show the reaction diagram
poor substrate
-
-
?
2-aminobenzoyl-RPIITTAGPSF(NO2)A + H2O
?
show the reaction diagram
-
-
-
?
2-aminobenzoyl-SAVLQSGF(NO2)A + H2O
?
show the reaction diagram
good substrate
-
-
?
2-naphthyl butyrate + H2O
2-naphthol + butanoate
show the reaction diagram
-
-
-
-
?
Abz-EFSPF(NO2)RA + H2O
?
show the reaction diagram
-
-
-
?
Abz-GFEPF(NO2)RA + H2O
?
show the reaction diagram
-
-
-
?
Abz-KARVLF(NO2)EANle + H2O
?
show the reaction diagram
-
-
-
?
Abz-SAVLQSGF(NO2)A + H2O
?
show the reaction diagram
-
-
-
?
Ac-Ala-4-nitroanilide + H2O
acetyl-Ala + 4-nitroaniline
show the reaction diagram
-
-
-
-
?
Ac-Ala-7-amido-4-methylcoumarin + H2O
N-acetyl-L-Ala + 7-amino-4-methylcoumarin
show the reaction diagram
-
-
-
?
Ac-Leu-4-nitroanilide + H2O
N-acetyl-L-Leu + 4-nitroaniline
show the reaction diagram
-
-
-
?
Ac-Leu-p-nitroanilide + H2O
Ac-Leu + p-nitroaniline
show the reaction diagram
-
substrate peptidase assay
-
-
?
Ac-Phe-2-naphthylamide + H2O
?
show the reaction diagram
-
-
-
?
Ac-Phe-2-naphthylamide + H2O
N-acetyl-L-Phe + 2-naphthylamine
show the reaction diagram
-
-
-
?
Ac-Phe-4-nitroanilide + H2O
N-acetyl-L-Phe + 4-nitroaniline
show the reaction diagram
-
-
-
?
acety-Ala-Ala methyl ester + H2O
?
show the reaction diagram
-
-
-
-
?
acety-Ala-Ala-Phe-Gly + H2O
?
show the reaction diagram
-
-
-
-
?
acety-Ala-Gly-D-Ala-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
acetyl-Ala-4-nitroanilide + H2O
acetyl-Ala + 4-nitroaniline
show the reaction diagram
-
-
-
?
acetyl-Ala-7-amido-4-methylcoumarin + H2O
?
show the reaction diagram
very slow hydrolysis
-
-
?
acetyl-Ala-7-amido-4-methylcoumarin + H2O
acetyl-Ala + 7-amino-4-methylcoumarin
show the reaction diagram
synthetic construct
-
-
-
-
?
acetyl-Ala-Ala + H2O
acetyl-Ala + Ala
show the reaction diagram
Acetyl-Ala-Ala-Ala + H2O
Acetyl-Ala + Ala-Ala
show the reaction diagram
acetyl-Ala-Ala-Ala-Ala + H2O
acetyl-Ala + Ala-Ala-Ala
show the reaction diagram
acetyl-Ala-Met + H2O
acetyl-Ala + Met
show the reaction diagram
-
native enzyme shows 70.4% of the activity compared to acetyl-Ala-Ala as substrate
-
?
acetyl-Gly-Gly + H2O
acetyl-Gly + Gly
show the reaction diagram
acetyl-Gly-Leu + H2O
acetyl-Gly + Leu
show the reaction diagram
-
native enzyme shows 30.3% of the activity compared to acetyl-Ala-Ala as substrate
-
?
acetyl-Leu-4-nitroanilide + H2O
acetyl-Leu + 4-nitroaniline
show the reaction diagram
acetyl-Met-7-amido-4-methylcoumarin + H2O
acetyl-Met + 7-amino-4-methylcoumarin
show the reaction diagram
-
-
-
?
acetyl-Met-Ala + H2O
acetyl-Met + Ala
show the reaction diagram
acetyl-Met-Asn + H2O
acetyl-Met + Asn
show the reaction diagram
-
native enzyme shows 34.1% of the activity compared to acetyl-Ala-Ala as substrate
-
?
acetyl-Met-Glu + H2O
acetyl-Met + Glu
show the reaction diagram
acetyl-Met-Phe + H2O
acetyl-Met + Phe
show the reaction diagram
native enzyme shows 5% of the activity compared to acetyl-Ala-Ala as substrate
-
?
acetyl-Phe-2-naphthylamide + H2O
?
show the reaction diagram
classical substrate of AAP
-
-
?
acetyl-Phe-2-naphthylamide + H2O
acetyl-Phe + 2-naphthylamine
show the reaction diagram
-
-
-
?
acetyl-Phe-4-nitroanilide + H2O
acetyl-Phe + 4-nitroaniline
show the reaction diagram
specificity rate constant is lower by one order of magnitude for acetyl-Leu-4-nitroanilide than for acetyl-Phe-4-nitroanilide
-
-
?
Ala-Ala + H2O
Ala + Ala
show the reaction diagram
Ala-Ala-Ala + H2O
Ala + Ala-Ala
show the reaction diagram
Ala-Ala-Ala + H2O
Ala-Ala + Ala
show the reaction diagram
-
-
-
?
Ala-Ala-Ala-Ala + H2O
Ala + Ala-Ala-Ala
show the reaction diagram
Ala-Ala-Ala-Ala + H2O
Ala-Ala + Ala-Ala
show the reaction diagram
-
-
-
?
Ala-beta-naphthylamide + H2O
Ala + 2-naphthylamine
show the reaction diagram
Ala-p-nitroanilide + H2O
Ala + p-nitroaniline
show the reaction diagram
alpha-melanocyte stimulating hormone + H2O
?
show the reaction diagram
-
-
-
-
?
amyloid-beta peptide + H2O
?
show the reaction diagram
-
-
-
-
?
Asp-Ala-p-nitroanilide + H2O
?
show the reaction diagram
-
-
-
-
?
Asp-Pro-p-nitroanilide + H2O
?
show the reaction diagram
-
-
-
-
?
butyryl thiocholine + H2O
?
show the reaction diagram
-
-
-
-
?
butyryl-Ala-Ala-Ala + H2O
butyryl-Ala + Ala-Ala
show the reaction diagram
formyl-Ala-Ala-Ala + H2O
formyl-Ala + Ala-Ala
show the reaction diagram
formyl-Gly-Val + H2O
formyl-Gly + Val
show the reaction diagram
-
native enzyme shows 30.3% of the activity compared to acetyl-Ala-Ala as substrate
-
?
formylalanine-Ala-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
formylalanine-Ala-Ala-Ala-Ala-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
formylmethionine p-nitroanilide + H2O
formylmethionine + p-nitroaniline
show the reaction diagram
-
-
-
-
?
formylmethionine-Ala + H2O
formylmethionine + Ala
show the reaction diagram
-
-
-
-
?
formylmethionine-Ala-Ala-Ala-Ala-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
formylmethionine-Ala-Ser + H2O
?
show the reaction diagram
-
-
-
-
?
formylmethionine-beta-naphthylamide + H2O
formylmethionine + beta-naphthylamine
show the reaction diagram
-
-
-
-
?
formylmethionine-Leu + H2O
formylmethionine + Leu
show the reaction diagram
-
-
-
-
?
formylmethionine-Leu-Gly + H2O
?
show the reaction diagram
-
-
-
-
?
formylmethionine-Leu-Phe + H2O
?
show the reaction diagram
-
-
-
-
?
formylmethionine-Leu-Tyr + H2O
?
show the reaction diagram
-
-
-
-
?
formylmethionine-Phe + H2O
formylmethionine + Phe
show the reaction diagram
-
-
-
-
?
formylmethionine-Trp + H2O
formylmethionine + Trp
show the reaction diagram
-
-
-
-
?
formylmethionine-Val + H2O
formylmethionine + Val
show the reaction diagram
-
-
-
-
?
glutaryl-GGF-7-amido-4-methylcoumarin + H2O
?
show the reaction diagram
has a rate constant comparable to that of acetyl-Phe-2-naphthylamide
-
-
?
Gly-Ala-Ala + H2O
Gly-Ala + Ala
show the reaction diagram
-
-
-
?
Gly-Phe-2-naphthylamide + H2O
?
show the reaction diagram
-
-
-
?
Gly-Phe-2-naphthylamide + H2O
Gly-Phe + 2-naphthylamine
show the reaction diagram
-
-
-
?
glycated ribulose-1,5-diphosphate carboxylase/oxygenase protein + H2O
?
show the reaction diagram
-
no degradation of the native protein
-
?
isoAsp-Ala-p-nitroanilide + H2O
?
show the reaction diagram
-
-
-
-
?
isoD/DAEFRHDSGYEVHHQKLVFFAEDVGSNKGA-NH2 + H2O
?
show the reaction diagram
-
-
-
-
?
Leu-beta-naphthylamide + H2O
Leu + 2-naphthylamine
show the reaction diagram
N-acety-Ala-Ala + H2O
N-acetyl-Ala + Ala
show the reaction diagram
N-acety-Ala-Ala-Ala + H2O
N-acetyl-Ala + Ala-Ala
show the reaction diagram
-
-
-
?
N-acetyl-Ala ethyl ester + H2O
N-acetyl-Ala + ethanol
show the reaction diagram
-
-
-
?
N-acetyl-Ala p-nitroanilide + H2O
N-acetyl-Ala + p-nitroaniline
show the reaction diagram
N-acetyl-Ala-Ala + H2O
N-acetyl-Ala + Ala
show the reaction diagram
N-acetyl-Ala-Ala-Ala + H2O
N-acetyl-Ala + Ala-Ala
show the reaction diagram
N-acetyl-Ala-Ala-Ala-Ala + H2O
N-acetyl-Ala + Ala-Ala-Ala
show the reaction diagram
N-acetyl-Ala-Ala-Ala-Ala-Ala + H2O
?
show the reaction diagram
N-acetyl-Ala-Ala-Ala-Ala-Ala-Ala + H2O
?
show the reaction diagram
N-acetyl-Ala-Ala-Ala-Ala-Glu-Glu-Glu-Lys + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Ala-Gln-Nepsilon-acetyl-Lys + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Ala-Gln-Nepsilon-succinyl-Lys + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Ala-His-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Ala-Pro + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Asp + H2O
N-acetyl-Ala + Asp
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-beta-naphthylamide + H2O
N-acetyl-Ala + beta-naphthylamine
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Gly + H2O
N-acetyl-Ala + Gly
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Gly-Ala-D-Ala-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-His-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Leu + H2O
N-acetyl-Ala + Leu
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Lys + H2O
N-acetyl-Ala + Lys
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Met + H2O
N-acetyl-Ala + Met
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-p-nitroanilide + H2O
N-acetyl-Ala + p-nitroaniline
show the reaction diagram
N-acetyl-Ala-Phe + H2O
N-acetyl-Ala + Phe
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Ser + H2O
N-acetyl-Ala + Ser
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Thr + H2O
N-acetyl-Ala + Thr
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Trp + H2O
N-acetyl-Ala + Trp
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Tyr + H2O
N-acetyl-Ala + Tyr
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Tyr-Ile + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-alanyl-4-nitroanilide + H2O
N-acetyl-L-Ala + 4-nitroaniline
show the reaction diagram
-
-
-
-
?
N-acetyl-Glu p-nitroanilide + H2O
N-acetyl-Glu + p-nitroaniline
show the reaction diagram
-
-
-
-
?
N-acetyl-Gly-Ala + H2O
N-acetyl-Gly + Ala
show the reaction diagram
-
weak activity
-
-
?
N-acetyl-Gly-p-nitroanilide + H2O
N-acetyl-Gly + p-nitroaniline
show the reaction diagram
N-acetyl-L-Ala-4-nitroanilide + H2O
N-acetyl-L-Ala + 4-nitroaniline
show the reaction diagram
-
-
-
?
N-acetyl-L-alanine 4-nitroanilide + H2O
N-acetyl-L-alanine + 4-nitroaniline
show the reaction diagram
-
-
-
-
?
N-acetyl-L-alanyl 4-nitroanilide + H2O
N-acetyl-L-alanine + 4-nitroaniline
show the reaction diagram
N-acetyl-L-alanyl-p-nitroanilide + H2O
N-acetyl-L-alanine + p-nitroaniline
show the reaction diagram
N-acetyl-L-Leu-4-nitroanilide + H2O
N-acetyl-L-Leu + 4-nitroaniline
show the reaction diagram
-
-
-
?
N-acetyl-L-leucyl 4-nitroanilide + H2O
N-acetyl-L-leucine + 4-nitroaniline
show the reaction diagram
N-acetyl-L-Met-alpha-L-Lys-Ala-NH2 + H2O
N-acetyl-L-Met + L-Lys-Ala-NH2
show the reaction diagram
-
-
-
-
?
N-acetyl-L-Met-epsilon-L-Lys-Ala-NH2 + H2O
N-acetyl-L-Met + L-Lys-L-Ala-NH2
show the reaction diagram
-
-
-
?
N-acetyl-L-Phe-4-nitroanilide + H2O
N-acetyl-L-Phe + 4-nitroaniline
show the reaction diagram
-
-
-
?
N-acetyl-L-phenylalanyl 4-nitroanilide + H2O
N-acetyl-L-phenylalanine + 4-nitroaniline
show the reaction diagram
N-acetyl-Leu p-nitroanilide + H2O
N-acetyl-Leu + p-nitroaniline
show the reaction diagram
-
-
-
-
?
N-acetyl-Leu-4-nitroanilide + H2O
N-acetyl-L-Leu + 4-nitroaniline
show the reaction diagram
N-acetyl-Leu-4-nitroanilide + H2O
N-acetyl-Leu + 4-nitroaniline
show the reaction diagram
-
-
-
-
?
N-acetyl-Leu-Ala + H2O
N-acetyl-Leu + Ala
show the reaction diagram
-
-
-
-
?
N-acetyl-Leu-p-nitroanilide + H2O
N-acetyl-Leu + p-nitroaniline
show the reaction diagram
esterase activity of wild-type enzyme with p-nitrophenyl caprylate as substrate is 7times higher than peptidase activity with N-acetyl-Leu-p-nitroanilide as substrate, 150fold higher for mutant enzyme R526V, peptidase activity for mutant R526E is abolished
-
-
?
N-acetyl-Met-Ala + H2O
N-acetyl-Met + Ala
show the reaction diagram
N-acetyl-Met-Ala-Ala-Ala-Ala-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Met-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Met-Asp-Arg-Val-Leu-Ser-Arg-Tyr + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Met-Asp-Glu-Thr-Gly-Asp-Thr-Ala-Leu-Val-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Met-epsilon-Lys + H2O
N-acetyl-Met + Lys
show the reaction diagram
-
-
-
?
N-acetyl-Met-Leu + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Met-Leu-Gly + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Met-Leu-Phe + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Met-Lys + H2O
N-acetyl-Met + Lys
show the reaction diagram
-
-
-
?
N-acetyl-Met-p-nitroanilide + H2O
N-acetyl-Met + p-nitroaniline
show the reaction diagram
N-acetyl-Phe-2-naphthylamide + H2O
N-acetyl-L-Phe + 2-naphthylamine
show the reaction diagram
-
kinetic assay
-
-
?
N-acetyl-Phe-2-naphthylamide + H2O
N-acetyl-Phe + 2-naphthylamine
show the reaction diagram
N-acetyl-Phe-Ala + H2O
N-acetyl-Phe + Ala
show the reaction diagram
-
weak activity
-
-
?
N-acetyl-Ser-Ala + H2O
N-acetyl-Ser + Ala
show the reaction diagram
-
-
-
-
?
N-acetyl-Tyr p-nitroanilide + H2O
N-acetyl-Tyr + p-nitroaniline
show the reaction diagram
-
-
-
-
?
N-acetyl-Tyr-Ala + H2O
N-acetyl-Tyr + Ala
show the reaction diagram
-
weak activity
-
-
?
N-acylpeptide + H2O
?
show the reaction diagram
-
acylpeptide hydrolase catalyzes the hydrolysis of short peptides of the type Nalpha-acyl to form an acyl amino acid and a peptide with a free N-terminus
-
-
-
p-nitrophenyl acetate + H2O
4-nitrophenol + acetate
show the reaction diagram
-
-
-
-
?
p-nitrophenyl butyrate + H2O
?
show the reaction diagram
-
-
-
-
?
p-nitrophenyl caprylate + H2O
nitrophenol + caprylate
show the reaction diagram
esterase activity of wild-type enzyme with p-nitrophenyl caprylate as substrate is 7times higher than peptidase activity with N-acetyl-Leu-p-nitroanilide as substrate, 150fold higher for mutant enzyme R526V, peptidase activity for mutant R526E is abolished
-
-
?
p-nitrophenyl hexanoate + H2O
p-nitrophenol + hexanoate
show the reaction diagram
-
-
-
-
?
p-nitrophenyl propionate + H2O
p-nitrophenol + propionate
show the reaction diagram
-
-
-
-
?
p-nitrophenyl valerate + H2O
p-nitrophenol + pentanoate
show the reaction diagram
-
-
-
-
?
Phe-beta-naphthylamide + H2O
Phe + 2-naphthylamine
show the reaction diagram
-
-
-
-
?
Phe-p-nitroanilide + H2O
Phe + p-nitroaniline
show the reaction diagram
-
prefered substrate for PMH
-
-
?
Pro-beta-naphthylamide + H2O
Pro + 2-naphthylamine
show the reaction diagram
-
-
-
-
?
puromycin + H2O
?
show the reaction diagram
-
-
-
-
?
succinyl-AAA-4-nitroanilide + H2O
succinyl-AAA + 4-nitroaniline
show the reaction diagram
-
-
-
?
succinyl-AAPF-2-naphthylamide + H2O
?
show the reaction diagram
hydrolysed at a significantly slower rate than acetyl-Phe-2-naphthylamide
-
-
?
succinyl-GGF-4-nitroanilide + H2O
succinyl-GGF + 4-nitroaniline
show the reaction diagram
-
-
-
?
Tyr-beta-naphthylamide + H2O
Tyr + 2-naphthylamine
show the reaction diagram
-
-
-
-
?
Tyr-Leu + H2O
Tyr + Leu
show the reaction diagram
Tyr-Phe + H2O
Tyr + Phe
show the reaction diagram
Z-GGL-4-nitroanilide + H2O
Z-GGL + 4-nitroaniline
show the reaction diagram
-
-
-
?
additional information
?
-
NATURAL SUBSTRATES
NATURAL PRODUCTS
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
REVERSIBILITY
r=reversible
ir=irreversible
?=not specified
additional information
?
-
METALS and IONS
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
SCN-
-
0.1-0.5 M, activates towards N-acetyl-Ala p-nitroanilide and N-acetyl-Ala beta-naphthylamide
INHIBITORS
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
(10E,12Z)-octadeca-10,12-dienoic acid
-
non-competitive inhibition mechanism
1-butane boronic acid
-
-
1-ethyl-3,3'-dimethylaminopropylcarbodiimide
-
-
1-methylethyl dodecylphosphonofluoridoate
2-(octyloxy)-4H-1,3,2-benzodioxaphosphinine 2-oxide
2-(pentylsulfanyl)-4H-1,3,2-benzodioxaphosphinine 2-oxide
2-heptyl-4H-1,3,2-benzodioxaphosphinine 2-oxide
4-(2-aminoethyl) benzenesulfonyl fluoride
-
-
5,5'-dithiobis-(2-nitrobenzoate)
-
partial
Ac-Ala
-
competitive inhibitor
Ac-Gly-prolineboronic acid
synthetic construct
-
-
Ac-Leu-CH2-Cl
-
irreversible inhibitor
Ac-Met
-
competitive inhibitor
Ac-Phe-OH
-
product-like inhibitor
acephate
-
IC50: 0.0062 mM
acetyl-Gly-prolineboronic acid
synthetic construct
-
selectivity for APH 25fold higher than for fibroblast activation protein
Acetyl-Phe
activated-thiol-Sepharose
-
-
-
ampicillin
-
partial
bis(1-methylethyl) 4-nitrophenyl phosphate
-
IC50: 0.016 mM
bis(sulfosuccinimidyl)suberate
-
-
CaCl2
100 mM, 52% inhibition
carbodiimide/aminoalkyl-agarose
-
-
-
carbodiimide/dicarboxylic acid
-
-
-
chlorfenvinphos
-
IC50 at pH 7.4, 37C: 1386 nM
chlorpyrifos
chlorpyrifos cyclohexyl
chlorpyrifos isopropyl
-
IC50: 0.0033 mM
chlorpyrifos methyl
chlorpyrifos n-butyl
-
IC50: 0.00006 mM
chlorpyrifos n-propyl
-
IC50: 0.00007 mM
chlorpyrifos-methyl oxon
-
IC50 at pH 7.4, 37C: 18.3 nM
Cl-
-
activity towards N-acetyl-Ala-Ala and N-acetyl-Ala-Ala-Ala
CoCl2
-
1 mM, 21% inhibition
di(2-pyridyl)disulfide
-
-
diazoxon
dichlorvos
dicyclohexyl 2,2-dichloroethenyl phosphate
diethyl 4-methyl-3-nitrophenyl phosphate
-
IC50: 0.002 mM
diethyl dicarbonate
diisopropyl fluorophosphate
diisopropylfluorophosphate
dipentyl fluorophosphate
diphenylphosphinic fluoride
dithiothreitol
-
-
ebelactone A
-
-
EDTA
1 mM, 10% inhibition
epoxy-Sepharose
-
-
-
ethyl octylphosphonofluoridoate
FeCl2
-
1 mM, 21% inhibition
Glutaraldehyde
-
-
Gly methyl ester
-
-
Guanidine-HCl
1 M, complete loss of activity, after removal of guanidine-HCl the enzyme recovers 25% of its activity
guanidine/HCl
-
1 M, complete inactivation
heptyl ethylphosphonofluoridoate
iodoacetamide
iodoacetic acid
K+
1 mM, 4% inhibition
malaoxon
-
IC50 at pH 7.4, 37C: 1400000 nM
Mipafox
-
IC50 at pH 7.4, 37C: 3013 nM
N,N-Dimethylformamide
-
-
N-acetyl-Ala
N-acetyl-Ala chloromethyl ketone
-
inactivation follows first order kinetics, acetyl-Ala protects
N-acetyl-Leu chloromethyl ketone
-
-
N-acetyl-Met
N-acetyl-Val
-
-
N-ethyl-5-phenylisoxazolium 3'-sulfonate
-
i.e. Woodward's reagent
N-hydroxysuccinimide agarose
-
-
-
NaCl
-
1 mM, 78% loss of activity
nonyl ethylphosphonofluoridoate
octane-1-sulfonyl fluoride
octyl methylphosphonofluoridoate
p-hydroxymercuribenzoate
-
-
p-nitrophenyl-N-propyl carbamate
-
potent active site-directed, pseudo-first-order kinetics
Paraoxon
penicillin G
-
partial
pentyl ethylphosphonofluoridoate
peptide SsCEI 2
-
specific and efficient inhibition. No inhibition in presence of peptide SsCEI 3 and peptide SsCEI 4
-
phenylmethylsulfonyl fluoride
-
-
phosphatidylethanolamine-binding protein inhibitor SsCEI
-
-
-
profenofos
-
IC50: 0.002 mM
SCN-
-
activity towards N-acetyl-Ala-Ala and N-acetyl-Ala-Ala-Ala
Sulfolobus solfataricus chymotrypsin-elastase inhibitor
specific inhibition
-
thimerosal
-
-
Trichlorfon
-
IC50: 0.018 mM
tridecyl methylphosphonofluoridoate
Triton X-100
1 mg/ml, 4% inhibition
Tween 20
1 mg/ml, 10% inhibition
Tween 80
1 mg/ml, 18% inhibition
additional information
ACTIVATING COMPOUND
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
dithiothreitol
-
maintains catalytic activity of PMH
KM VALUE [mM]
SUBSTRATE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
0.00129 - 0.0071
2-aminobenzoyl-Ala-Leu-Phe-Gln-Gly-Pro-Phe(NO2)-Ala
0.06
4-nitrophenyl hexanoate
-
-
0.00913 - 1.76
Ac-Leu-p-nitroanilide
0.12
acetyl-Ala-4-nitroanilide
15C, pH 8
0.11
acetyl-Met-7-amido-4-methylcoumarin
50C, pH 8
0.0082 - 0.1
acetyl-Phe-2-naphthylamide
0.39
Ala-beta-naphthylamide
-
-
1
butyryl thiocholine
-
-
1.7
formylmethionine-beta-naphthylamide
-
-
0.04
formylmethionine-Leu
-
-
0.18
formylmethionine-Leu-Phe
-
-
0.22
formylmethionine-Leu-Tyr
-
-
0.63
formylmethionine-Phe
-
-
0.71
formylmethionine-Trp
-
-
0.06
formylmethionine-Val
-
-
0.12
Leu-beta-naphthylamide
-
-
1.8 - 18.4
N-acetyl-Ala p-nitroanilide
0.616
N-acetyl-Ala-4-nitroanilide
-
-
0.8 - 7.6
N-acetyl-Ala-Ala
0.6
N-acetyl-Ala-Ala-Ala
-
-
0.8 - 13
N-acetyl-Ala-Ala-Ala-Ala
1.7
N-acetyl-Ala-Ala-Arg-Gly
-
-
2
N-acetyl-Ala-Ala-Phe-Gly
-
-
3.6
N-acetyl-Ala-Ala-Pro-Ala
-
-
0.006 - 4.6
N-acetyl-Ala-p-nitroanilide
0.8
N-acetyl-L-Ala-4-nitroanilide
11.4
N-acetyl-L-alanyl 4-nitroanilide
pH 7.5, 80C
0.6
N-acetyl-L-Leu-4-nitroanilide
in 25 mM Tris-HCl buffer pH 7.5, at 90C
-
0.3 - 0.6
N-acetyl-L-leucyl 4-nitroanilide
0.04
N-acetyl-L-Phe-4-nitroanilide
in 25 mM Tris-HCl buffer pH 7.5, at 90C
-
4
N-acetyl-L-phenylalanyl 4-nitroanilide
pH 7.5, 90C
11
N-acetyl-Leu p-nitroanilide
-
-
0.4 - 10.5
N-acetyl-Leu-p-nitroanilide
0.49 - 0.68
N-acetyl-Met-Ala
0.02
N-acetyl-Met-Leu
-
-
0.16
N-acetyl-Met-Leu-Phe
-
-
0.00566 - 0.1
N-acetyl-Phe-2-naphthylamide
0.01
naphthyl butyrate
-
-
35.7 - 114.6
p-nitrophenyl caprylate
0.63
p-Nitrophenylacetate
-
-
0.02
p-nitrophenylbutyrate
-
-
0.16
p-nitrophenylpropionate
-
-
0.07
p-nitrophenylvalerate
-
-
0.028
Phe-beta-naphthylamide
-
-
0.013
Pro-beta-naphthylamide
-
-
1.91
puromycin
-
-
0.067
Tyr-beta-naphthylamide
-
-
TURNOVER NUMBER [1/s]
SUBSTRATE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
0.000917 - 8.2
2-aminobenzoyl-Ala-Leu-Phe-Gln-Gly-Pro-Phe(NO2)-Ala
0.49 - 36.4
Ac-Leu-p-nitroanilide
0.014 - 1.7
acetyl-Ala-4-nitroanilide
0.09
acetyl-Leu-4-nitroanilide
Trematomus bernacchii
V5QZ74
15C, pH 8
0.03 - 7.74
acetyl-Met-7-amido-4-methylcoumarin
8.79
Ala-beta-naphthylamide
Streptomyces morookaense
-
-
76.4
formylmethionine-beta-naphthylamide
Rattus norvegicus
-
-
5.17
formylmethionine-Leu
Rattus norvegicus
-
-
12.3
formylmethionine-Leu-Phe
Rattus norvegicus
-
-
15.5
formylmethionine-Leu-Tyr
Rattus norvegicus
-
-
70.2
formylmethionine-Phe
Rattus norvegicus
-
-
31.3
formylmethionine-Trp
Rattus norvegicus
-
-
5.94
formylmethionine-Val
Rattus norvegicus
-
-
4.07
Leu-beta-naphthylamide
Streptomyces morookaense
-
-
17.3
N-acetyl-Ala p-nitroanilide
Pyrococcus horikoshii
-
-
790
N-acetyl-Ala-Ala
Pyrococcus horikoshii
-
-
281
N-acetyl-Ala-Ala-Ala-Ala
Pyrococcus horikoshii
-
-
461
N-acetyl-Ala-p-nitroanilide
Sus scrofa
-
pH 7.5
17.5
N-acetyl-L-Ala-4-nitroanilide
Sulfolobus solfataricus
Q97VD6
in 25 mM Tris-HCl buffer pH 7.5, at 90C
-
5 - 14
N-acetyl-L-alanyl 4-nitroanilide
18
N-acetyl-L-Leu-4-nitroanilide
Sulfolobus solfataricus
Q97VD6
in 25 mM Tris-HCl buffer pH 7.5, at 90C
-
5 - 18
N-acetyl-L-leucyl 4-nitroanilide
2
N-acetyl-L-Phe-4-nitroanilide
Sulfolobus solfataricus
Q97VD6
in 25 mM Tris-HCl buffer pH 7.5, at 90C
-
8
N-acetyl-L-phenylalanyl 4-nitroanilide
Sulfolobus solfataricus
Q97VD6
pH 7.5, 90C
330
N-acetyl-Leu p-nitroanilide
Pyrococcus horikoshii
-
-
0.5 - 26.9
N-acetyl-Leu-p-nitroanilide
13.4 - 33
N-acetyl-Met-Ala
5.45
N-acetyl-Met-Leu
Rattus norvegicus
-
-
27.1
N-acetyl-Met-Leu-Phe
Rattus norvegicus
-
-
4.28
N-acetyl-Phe-2-naphthylamide
Aeropyrum pernix
-
pH 7.0, 70C, wild-type enzyme
6.6 - 30.9
p-nitrophenyl caprylate
1.69
Phe-beta-naphthylamide
Streptomyces morookaense
-
-
1.61
Pro-beta-naphthylamide
Streptomyces morookaense
-
-
0.98
puromycin
Streptomyces morookaense
-
-
1.85
Tyr-beta-naphthylamide
Streptomyces morookaense
-
-
additional information
additional information
Oryctolagus cuniculus
-
-
-
kcat/KM VALUE [1/mMs-1]
SUBSTRATE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
0.129 - 6347
2-aminobenzoyl-Ala-Leu-Phe-Gln-Gly-Pro-Phe(NO2)-Ala
4.76
acetyl-Ala-4-nitroanilide
Trematomus bernacchii
V5QZ74
37C, pH 8
111962
4.72
acetyl-Met-7-amido-4-methylcoumarin
Trematomus bernacchii
V5QZ74
50C, pH 8
202293
17.5
N-acetyl-L-Ala-4-nitroanilide
Sulfolobus solfataricus
Q97VD6
in 25 mM Tris-HCl buffer pH 7.5, at 90C
202469
0.4 - 17.5
N-acetyl-L-alanyl 4-nitroanilide
32.7
N-acetyl-L-Leu-4-nitroanilide
Sulfolobus solfataricus
Q97VD6
in 25 mM Tris-HCl buffer pH 7.5, at 90C
202468
16.8 - 32.7
N-acetyl-L-leucyl 4-nitroanilide
2
N-acetyl-L-Phe-4-nitroanilide
0.414 - 865
N-acetyl-Phe-2-naphthylamide
0.2
succinyl-AAA-4-nitroanilide
Sulfolobus solfataricus
Q97VD6
in 25 mM Tris-HCl buffer pH 7.5, at 90C
202544
1.3
succinyl-GGF-4-nitroanilide
Sulfolobus solfataricus
Q97VD6
in 25 mM Tris-HCl buffer pH 7.5, at 90C
202542
0.7
Z-GGL-4-nitroanilide
Sulfolobus solfataricus
Q97VD6
in 25 mM Tris-HCl buffer pH 7.5, at 90C
202543
Ki VALUE [mM]
INHIBITOR
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
0.14
(10E,12Z)-octadeca-10,12-dienoic acid
-
pH 7.5, 37C
0.000575
Ac-Gly-prolineboronic acid
synthetic construct
-
-
0.0105 - 0.0178
Ac-Phe-OH
0.0178
Acetyl-Phe
-
mutant H367A
0.001
peptide SsCEI 2
-
pH 7.5, 37C
-
0.00002 - 0.008
phosphatidylethanolamine-binding protein inhibitor SsCEI
IC50 VALUE [mM]
INHIBITOR
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
0.08
(10E,12Z)-octadeca-10,12-dienoic acid
Sulfolobus solfataricus
-
pH 7.5, 37C
0.00026 - 0.0015
1-methylethyl dodecylphosphonofluoridoate
0.00018 - 0.00023
2-(octyloxy)-4H-1,3,2-benzodioxaphosphinine 2-oxide
0.0011 - 0.0015
2-(pentylsulfanyl)-4H-1,3,2-benzodioxaphosphinine 2-oxide
0.0014 - 0.0016
2-heptyl-4H-1,3,2-benzodioxaphosphinine 2-oxide
0.0062
acephate
Homo sapiens
-
IC50: 0.0062 mM
0.016
bis(1-methylethyl) 4-nitrophenyl phosphate
Homo sapiens
-
IC50: 0.016 mM
0.001386
chlorfenvinphos
Sus scrofa
-
IC50 at pH 7.4, 37C: 1386 nM
0.000021 - 0.000071
chlorpyrifos
0.00035 - 0.00086
chlorpyrifos cyclohexyl
0.0033
chlorpyrifos isopropyl
Homo sapiens
-
IC50: 0.0033 mM
0.00008 - 0.00031
chlorpyrifos methyl
0.00006
chlorpyrifos n-butyl
Homo sapiens
-
IC50: 0.00006 mM
0.00007
chlorpyrifos n-propyl
Homo sapiens
-
IC50: 0.00007 mM
0.0000183
chlorpyrifos-methyl oxon
Sus scrofa
-
IC50 at pH 7.4, 37C: 18.3 nM
0.0000225
DFP
Sus scrofa
-
IC50 at pH 7.4, 37C: 22.5 nM
0.00089 - 0.001386
diazoxon
0.0001186 - 0.00056
dichlorvos
0.0001 - 0.00025
dicyclohexyl 2,2-dichloroethenyl phosphate
0.002
diethyl 4-methyl-3-nitrophenyl phosphate
Homo sapiens
-
IC50: 0.002 mM
0.000011 - 0.000017
diisopropylfluorophosphate
0.0000099 - 0.000011
dipentyl fluorophosphate
0.00024 - 0.00041
diphenylphosphinic fluoride
0.00011 - 0.00021
ethyl octylphosphonofluoridoate
0.000027 - 0.00023
heptyl ethylphosphonofluoridoate
1.4
malaoxon
Sus scrofa
-
IC50 at pH 7.4, 37C: 1400000 nM
0.003013
Mipafox
Sus scrofa
-
IC50 at pH 7.4, 37C: 3013 nM
0.00037 - 0.00087
naled
0.000052 - 0.00028
nonyl ethylphosphonofluoridoate
0.067 - 0.073
octane-1-sulfonyl fluoride
0.000043 - 0.00016
octyl methylphosphonofluoridoate
0.003805 - 0.0047
Paraoxon
0.00013 - 0.00027
pentyl ethylphosphonofluoridoate
0.01
peptide SsCEI 2
Sulfolobus solfataricus
-
pH 7.5, 37C
-
0.00000002
phosphatidylethanolamine-binding protein inhibitor SsCEI
Sulfolobus solfataricus
Q7LX61
pH 7.5, 80C, substrate: N-acetyl-L-leucyl 4-nitroanilide
-
0.002
profenofos
Homo sapiens
-
IC50: 0.002 mM
0.018
Trichlorfon
Homo sapiens
-
IC50: 0.018 mM
0.00032 - 0.0048
tridecyl methylphosphonofluoridoate
SPECIFIC ACTIVITY [µmol/min/mg]
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
0.0007
cellular extract, using N-acetyl-L-Leu-4-nitroanilide as substrate, at pH 7.5 and 90C
0.124
-
recombinant enzyme, after the induction with IPTG, at 8 h of culture in LB medium
0.172
-
recombinant enzyme, after the induction with IPTG, at 18 h of culture in TB medium
4.8
after 6857fold purification, using N-acetyl-L-Leu-4-nitroanilide as substrate, at pH 7.5 and 90C; pH 7.5, 90C
13
-
with Tyr-Leu as substrate
19
-
with Tyr-Phe as substrate
23
-
with Ala-p-nitroanilide as substrate
109.2
-
-
154
-
with Phe-p-nitroanilide as substrate
186
-
with Ala-beta-naphthylamide as substrate
1490
-
-
additional information
pH OPTIMUM
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
4.8 - 5.5
-
at 85C
6
-
hydrolysis of N-acetyl-Glu p-nitroanilide
7.2 - 7.6
-
-
7.2
-
activity assay
7.4
-
assay at
7.5
-
wild-type enzyme
7.5 - 8
-
hydrolysis of N-acetyl-Ala p-nitroanilide
7.5
-
-
7.5 - 9
-
hydrolysis of formylmethionine-beta-naphthylamide or Met-Met-Leu-Phe
7.5
-
hydrolysis of N-acetyl-Ala p-nitroanilide
8.3
-
hydrolysis of N-acetyl-Ala p-nitroanilide
8.8
-
wild-type enzyme
pH RANGE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
5 - 8
-
about 60% of maximal activity at pH 5 and pH 8
5 - 9
more than 50% activity between pH 5.0 and 9.0
5.8 - 8.8
-
pH 5.8: about% of maximal activity, pH 8.8: about% of maximal activity
6 - 9.5
pH 6.0: about 65% of maximal activity, pH 9.5: about 70% of maximal activity
7 - 9
-
about 55% of maximal activity at pH 7 and at pH 13
7.5 - 9.5
-
pH 7.5: about 50% of maximal activity, pH 9.5: about 65% of maximal activity, wild-type enzyme
7.5 - 8
pH 7.5: about 55% of maximal activity, pH 8.0: about 75% of maximal activity
TEMPERATURE OPTIMUM
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
30
-
activity assay
74
-
wild-type
75
-
truncated mutant of apAPH that lacks the first short alpha-helix at the N-terminal
77
-
mutant DELTAN21
92
-
mutant D15A above 92; mutant R18A above 92
TEMPERATURE RANGE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
60 - 80
-
60C: about 40% of maximal activity, 80C: optimum
60 - 90
more than 50% activity between 60 and 90C
80 - 95
80C: about 65% of maximal activity, 95C: about 50% of maximal activity
pI VALUE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
5.5
-
isoelectric focusing
SOURCE TISSUE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
SOURCE
-
-
Manually annotated by BRENDA team
-
isolated from serum-free conditioned medium
Manually annotated by BRENDA team
; strong expression
Manually annotated by BRENDA team
-
isolated from serum-free conditioned medium
Manually annotated by BRENDA team
PDB
SCOP
CATH
ORGANISM
UNIPROT
Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
MOLECULAR WEIGHT
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
73230
-
calculated, monomer
81300
-
ion-spray mass spectrometry
125000
gel filtration
126100
-
calculated, dimer
130000
-
mass spectroscopy
192000
gel filtration
230000 - 245000
-
gel filtration
260000
-
heat-activated enzyme, light-scattering photometry
265000
-
gel filtration
280000
290000 - 320000
-
gel filtration
300000
320000 - 340000
-
gel filtration
350000
360000
-
gel filtration
423000
-
sucrose density gradient ultracentrifugation
SUBUNITS
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
hexamer
homodimer
homotrimer
tetramer
trimer
-
3 * 76000-80000, SDS-PAGE
additional information
Crystallization/COMMENTARY
ORGANISM
UNIPROT
LITERATURE
crystals grown at 17.8C using ammonium phosphate as a precipitant. Crystals belong to space group P1 with unit-cell parameters a = 107.5, b = 109.9, alpha = 108.1, beta = 109.8 and gamma = 91.9
-
crystals of the H367A mutant grown at 20C in hanging drops, to 2.2 A resolution. Belongs to space group P212121
-
hanging drop method, crystal structure determination of the native and two mutant structures (D524N and D524A)
-
hanging-drop vapor-diffusion method. The best crystals were obtained from reservoir of 6% PEG4000, 50 mM/l NaAc (pH 4.6), 15 mM/l DTT, 0.2 mM/l EDTA
-
by hanging drop method. AAP crystallized with the product-like inhibitors Ac-Phe and Gly-Phe, as well as with the substrate Abz-GFEPF(NO2)RA. Mutant S445A crystallized with Abz-GFEPF(NO2)RA. Complexes belong to P212121. Crystal structures of AAPinhibitor complexes reveal the oxyanion-binding site and the specificities of the S1, S2 and S3 subsites. Substrate-binding site extends beyond the S2 subsite, being capable of binding peptides with a longer N-terminus. The S2 subsite displays a non-polar character. The S3 site reveals a hydrophobic region that does not form hydrogen bonds with the inhibitor P3 residue. The enzymeinhibitor complexes reveal that, upon ligand-binding, the S1 subsite undergoes significant conformational changes
-
hanging-drop vapor diffusion method, 2.5 A resolution, space group: P2(1)2(1)2(1), unit cell parameters: a = 63.1 A, b = 102.3 A, c = 163.9 A, truncated mutant of apAPH that lacks the first short alpha-helix at the N-terminal is cloned and expressed in Escherichia coli
-
the crystal structure of the H367A variant of ApAAP is determined and refined to a resolution of 2.2 A
-
crystallized using microbatch-under-oil employing the random microseed matrix screening method. The protein crystallizes in space group P2(1)1, with unit-cell parameters a: 77.6, b: 189.6, c: 120.4 A, beta: 108.4
-
crystals are grown at 20C by the hanging drop method
-
crystallized in mother liquor containing 0.1 M TrisHCl pH 7.0, 10%(w/v) polyethylene glycol 8000, 50 mM MgCl2 and 1%(w/v) CHAPS using the hanging-drop vapour-diffusion technique, 3.4 A resolution, space group C222, unit-cell parameters a = 84.8 A, b = 421.1 A, c = 212.0 A, four molecules in the asymmetric unit
-
pH STABILITY
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
5
-
rapid loss of activity below
95253
5.4
-
0.25 M ammonium sulfate, stable for 6 weeks
95253
6 - 8
-
stable
95253
6 - 10
25C, 24 h, over 85% activity remaining
724738
TEMPERATURE STABILITY
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
0 - 100
-
the major conformation of the enzyme remains stable
10 - 20
enzyme retains 80% activity after 7h of incubation; enzyme retains 80% activity after 7h of incubation
37
complete inactivation after 5 h of incubation; residual activity halved after 5 h of incubation
70 - 90
the enzyme retains 30% activity following the incubation for 24 h at 70C while the residual activity of the enzyme is halved after 4 h incubation at 90C
95
-
24 h, stable
additional information
GENERAL STABILITY
ORGANISM
UNIPROT
LITERATURE
1 M guanidine-HCl, activity is completely abolished. Dialysis results in 15-20% recovery of enzyme activity. In 1 M guanidine HCl the enzyme loses both its secondary and tertiary structures and dissociates into monomers of 70000 Da. Both monomeric and dimeric species are observed after 24 h dialysis of the enzyme denatured with guanidine-HCl. Both the monomer and dimer forms recovered after dialysis are active
-
75% loss of activity in 0.1 M guanidine hydrochloride at 37C after 200 min
-
8 M urea, 1 h, 25C, 85% loss of activity. Complete recovery on dialysis or 50fold dilution of the denatured enzyme. The enzyme lost its secondary structure at urea concentrations of 2 M and higher, whereas the tertiary structure is minimally perturbed below 4 M urea
-
complete loss of activity upon freezing or lyophilization in the presence of beta-mercaptoethanol. In the absence of thiol the enzyme loses 50% of its activity on lyophilization
-
coupling to CNBr-Sepharose and cross-linking with dimethylsuberimidate improves the thermal stability. This treatment also enhances resistance to inactivation by ionic detergent and the organic solvent N,N-dimethylformamide
-
fully resistant to digestion by trypsin, chymotrypsin and elastase
-