Sequence of P4H3_ARATH

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
procollagen-proline 4-dioxygenase
Q9LN20
Arabidopsis thaliana
287
32867
Reaction
procollagen L-proline + 2-oxoglutarate + O2 = procollagen trans-4-hydroxy-L-proline + succinate + CO2
Sequences with same EC No.
Sequence
show sequence in normal format
>Q9LN20|procollagen-proline 4-dioxygenase|EC 1.14.11.2|Arabidopsis thaliana|Swiss-Prot
MAKLRHSRFQARKWSTLMLVLFMLFMLTIVLLMLLAFGVFSLPINNDESSPIDLSYFRRA
ATERSEGLGKRGDQWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVDSETGK
SKDSRVRTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDY
FVDEFNTKNGGQRMATMLMYLSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSVKP
RMGDALLFWSMRPDATLDPTSLHGGCPVIRGNKWSSTKWMHVGEYKI
Download this sequence
in fasta format
Download all sequences for 1.14.11.2
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
438963
Theologis A.,Ecker J.R.,Palm C.J.,Federspiel N.A.,Kaul S.,White O.,Alonso J.,Altafi H.,Araujo R.,Bowman C.L.,Brooks S.Y.,Buehler E.,Chan A.,Chao Q.,Chen H.,Cheuk R.F.,Chin C.W.,Chung M.K.,Conn L.,Conway A.B.,Conway A.R.,Creasy T.H.,Dewar K.,Dunn P.,Etgu P.,Feldblyum T.V.,Feng J.-D.,Fong B.,Fujii C.Y.,Gill J.E.,Goldsmith A.D.,Haas B.,Hansen N.F.,Hughes B.,Huizar L.,Hunter J.L.,Jenkins J.,Johnson-Hopson C.,Khan S.,Khaykin E.,Kim C.J.,Koo H.L.,Kremenetskaia I.,Kurtz D.B.,Kwan A.,Lam B.,Langin-Hooper S.,Lee A.,Lee J.M.,Lenz C.A.,Li J.H.,Li Y.-P.,Lin X.,Liu S.X.,Liu Z.A.,Luros J.S.,Maiti R.,Marziali A.,Militscher J.,Miranda M.,Nguyen M.,Nierman W.C.,Osborne B.I.,Pai G.,Peterson J.,Pham P.K.,Rizzo M.,Rooney T.,Rowley D.,Sakano H.,Salzberg S.L.,Schwartz J.R.,Shinn P.,Southwick A.M.,Sun H.,Tallon L.J.,Tambunga G.,Toriumi M.J.,Town C.D.,Utterback T.,Van Aken S.,Vaysberg M.,Vysotskaia V.S.,Walker M.,Wu D.,Yu G.,Fraser C.M.,Venter J.C.,Davis R.W.
Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
Nature
408
816-820
2000
438964
Cheng C.Y.,Krishnakumar V.,Chan A.P.,Thibaud-Nissen F.,Schobel S.,Town C.D.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Plant J.
89
789-804
2017