Sequence of P4H11_ARATH

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
procollagen-proline 4-dioxygenase
Q9SZT0
Arabidopsis thaliana
272
30754
Reaction
procollagen L-proline + 2-oxoglutarate + O2 = procollagen trans-4-hydroxy-L-proline + succinate + CO2
Sequences with same EC No.
Sequence
show sequence in normal format
>Q9SZT0|procollagen-proline 4-dioxygenase|EC 1.14.11.2|Arabidopsis thaliana|Swiss-Prot
MSKSTSVSTILYLRQRLQGLKIYETSDLIQHINTFDELVGEQVSVDVKIEEKTKDMILLC
SLSPLLTTLTCSMVKVAASLRFPNERWLEVITKEPRAFVYHNFLALFFKICKTNEECDHL
ISLAKPSMARSKVRNALTGLGEESSSRTSSGTFIRSGHDKIVKEIEKRISEFTFIPQENG
ETLQVINYEVGQKFEPHFDGFQRIATVLMYLSDVDKGGETVFPEAKGIKSKKGVSVRPKK
GDALLFWSMRPDGSRDPSSKHGKRHCLSLNLF
Download this sequence
in fasta format
Download all sequences for 1.14.11.2
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
438937
Mayer K.F.X.,Schueller C.,Wambutt R.,Murphy G.,Volckaert G.,Pohl T.,Duesterhoeft A.,Stiekema W.,Entian K.-D.,Terryn N.,Harris B.,Ansorge W.,Brandt P.,Grivell L.A.,Rieger M.,Weichselgartner M.,de Simone V.,Obermaier B.,Mache R.,Mueller M.,Kreis M.,Delseny M.,Puigdomenech P.,Watson M.,Schmidtheini T.,Reichert B.,Portetelle D.,Perez-Alonso M.,Boutry M.,Bancroft I.,Vos P.,Hoheisel J.,Zimmermann W.,Wedler H.,Ridley P.,Langham S.-A.,McCullagh B.,Bilham L.,Robben J.,van der Schueren J.,Grymonprez B.,Chuang Y.-J.,Vandenbussche F.,Braeken M.,Weltjens I.,Voet M.,Bastiaens I.,Aert R.,Defoor E.,Weitzenegger T.,Bothe G.,Ramsperger U.,Hilbert H.,Braun M.,Holzer E.,Brandt A.,Peters S.,van Staveren M.,Dirkse W.,Mooijman P.,Klein Lankhorst R.,Rose M.,Hauf J.,Koetter P.,Berneiser S.,Hempel S.,Feldpausch M.,Lamberth S.,Van den Daele H.,De Keyser A.,Buysshaert C.,Gielen J.,Villarroel R.,De Clercq R.,van Montagu M.,Rogers J.,Cronin A.,Quail M.A.,Bray-Allen S.,Clark L.,Doggett J.,Hall S.,Kay M.,Lennard N.,McLay K.,Mayes R.,Pettett A.,Rajandream M.A.,Lyne M.,Benes V.,Rechmann S.,Borkova D.,Bloecker H.,Scharfe M.,Grimm M.,Loehnert T.-H.,Dose S.,de Haan M.,Maarse A.C.,Schaefer M.,Mueller-Auer S.,Gabel C.,Fuchs M.,Fartmann B.,Granderath K.,Dauner D.,Herzl A.,Neumann S.,Argiriou A.,Vitale D.,Liguori R.,Piravandi E.,Massenet O.,Quigley F.,Clabauld G.,Muendlein A.,Felber R.,Schnabl S.,Hiller R.,Schmidt W.,Lecharny A.,Aubourg S.,Chefdor F.,Cooke R.,Berger C.,Monfort A.,Casacuberta E.,Gibbons T.,Weber N.,Vandenbol M.,Bargues M.,Terol J.,Torres A.,Perez-Perez A.,Purnelle B.,Bent E.,Johnson S.,Tacon D.,Jesse T.,Heijnen L.,Schwarz S.,Scholler P.,Heber S.,Francs P.,Bielke C.,Frishman D.,Haase D.,Lemcke K.,Mewes H.-W.,Stocker S.,Zaccaria P.,Bevan M.,Wilson R.K.,de la Bastide M.,Habermann K.,Parnell L.,Dedhia N.,Gnoj L.,Schutz K.,Huang E.,Spiegel L.,Sekhon M.,Murray J.,Sheet P.,Cordes M.,Abu-Threideh J.,Stoneking T.,Kalicki J.,Graves T.,Harmon G.,Edwards J.,Latreille P.,Courtney L.,Cloud J.,Abbott A.,Scott K.,Johnson D.,Minx P.,Bentley D.,Fulton B.,Miller N.,Greco T.,Kemp K.,Kramer J.,Fulton L.,Mardis E.,Dante M.,Pepin K.,Hillier L.W.,Nelson J.,Spieth J.,Ryan E.,Andrews S.,Geisel C.,Layman D.,Du H.,Ali J.,Berghoff A.,Jones K.,Drone K.,Cotton M.,Joshu C.,Antonoiu B.,Zidanic M.,Strong C.,Sun H.,Lamar B.,Yordan C.,Ma P.,Zhong J.,Preston R.,Vil D.,Shekher M.,Matero A.,Shah R.,Swaby I.K.,O'Shaughnessy A.,Rodriguez M.,Hoffman J.,Till S.,Granat S.,Shohdy N.,Hasegawa A.,Hameed A.,Lodhi M.,Johnson A.,Chen E.,Marra M.A.,Martienssen R.,McCombie W.R.
Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana.
Nature
402
769-777
1999
438938
Cheng C.Y.,Krishnakumar V.,Chan A.P.,Thibaud-Nissen F.,Schobel S.,Town C.D.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Plant J.
89
789-804
2017