Sequence of P4H10_ARATH

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
procollagen-proline 4-dioxygenase
F4JZ24
Arabidopsis thaliana
289
32598
Reaction
procollagen L-proline + 2-oxoglutarate + O2 = procollagen trans-4-hydroxy-L-proline + succinate + CO2
Sequences with same EC No.
Sequence
show sequence in normal format
>F4JZ24|procollagen-proline 4-dioxygenase|EC 1.14.11.2|Arabidopsis thaliana|Swiss-Prot
MMARPRNHRPSARKSSHSTLVFAVLIMSTFVILILLAFGILSVPSNNAGSSKANDLTSIV
RKTLQRSGEDDSKNERWVEIISWEPRASVYHNFLTKEECKYLIELAKPHMEKSTVVDEKT
GKSTDSRVRTSSGTFLARGRDKTIREIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHY
DYFMDEYNTRNGGQRIATVLMYLSDVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLSV
KPKMGDALLFWSMTPDATLDPSSLHGGCAVIKGNKWSSTKWLRVHEYKV
Download this sequence
in fasta format
Download all sequences for 1.14.11.2
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
438934
Kaneko T.,Kotani H.,Nakamura Y.,Sato S.,Asamizu E.,Miyajima N.,Tabata S.
Structural analysis of Arabidopsis thaliana chromosome 5. V. Sequence features of the regions of 1,381,565 bp covered by twenty one physically assigned P1 and TAC clones.
DNA Res.
5
131-145
1998
438935
Cheng C.Y.,Krishnakumar V.,Chan A.P.,Thibaud-Nissen F.,Schobel S.,Town C.D.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Plant J.
89
789-804
2017