Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of Q88QV2_PSEPK

EC Number:3.5.1.30

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
5-aminopentanamidase
Q88QV2
Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
264
29311
Reaction
5-aminopentanamide + H2O = 5-aminopentanoate + NH3
Other sequences found for EC No. 3.5.1.30

General information:

Sequence
show sequence in normal format
>Q88QV2|5-aminopentanamidase|EC 3.5.1.30|Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)|TrEMBL
MRIALYQGAPKPLDVPGNLQRLRHQAQLAADRGAQLLVCPEMFLSGYNIGLAQVERLAEA
ADGPAAMTVVEIAQAHRIAIVYGYPERGDDGAIYNSVQLIDAHGRSLSNYRKTHLFGELD
RSMFSPGADHFPVVELEGWKVGLLICYDIEFPENARRLALDGAELILVPTANMTPYDFTC
QVTVRARAQENQCYLVYANYCGAEDEIEYCGQSSIIGPDGSLLAMAGRDECQLLAELEHE
RVVQGRRAFPYLTDLRQELHLRKG
Download this sequence
in fasta format
Download all sequences for 3.5.1.30
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
58178847
Nelson K.E.,Weinel C.,Paulsen I.T.,Dodson R.J.,Hilbert H.,Martins dos Santos V.A.,Fouts D.E.,Gill S.R.,Pop M.,Holmes M.,Brinkac L.,Beanan M.,DeBoy R.T.,Daugherty S.,Kolonay J.,Madupu R.,Nelson W.,White O.,Peterson J.,Khouri H.,Hance I.,Chris Lee P.,Holtzapple E.,Scanlan D.,Tran K.,Moazzez A.,Utterback T.,Rizzo M.,Lee K.,Kosack D.,Moestl D.,Wedler H.,Lauber J.,Stjepandic D.,Hoheisel J.,Straetz M.,Heim S.,Kiewitz C.,Eisen J.A.,Timmis K.N.,Dusterhoft A.,Tummler B.,Fraser C.M.
Complete genome sequence and comparative analysis of the metabolically versatile Pseudomonas putida KT2440.
Environ. Microbiol.
4
799-808
2002