Sequence of STAD_SOLCO

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
stearoyl-[acyl-carrier-protein] 9-desaturase
Q41319
Solanum commersonii
393
44833
Reaction
stearoyl-[acyl-carrier protein] + 2 reduced ferredoxin [iron-sulfur] cluster + O2 + 2 H+ = oleoyl-[acyl-carrier protein] + 2 oxidized ferredoxin [iron-sulfur] cluster + 2 H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>Q41319|stearoyl-[acyl-carrier-protein] 9-desaturase|EC 1.14.19.2|Solanum commersonii|Swiss-Prot
MALNFNSPTFQSIKTTRRPCSPLRSPRVFMASTLRPPSVEDGNVKKPFSPPREVHVQVTH
SMPPEKREIFDSLHGWADNNILVHLKPVEKCWQASDFLPDPASEGFEDQVKELRERCKEI
PDDYFVVLVGDMITEEALPTYQTMLNTLDGVRDETGASLTPWAIWTRAWTAEENRHGDLL
NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENNPYLGFIYTSFQERATFISHGNTARHA
KEHGDMKLAQVCGIIAADEKRHETAYTKIVEKLFEVDPDGTVLAVADMMRKKISMPAHLM
YDGRDDNLFEHFSTVAQRLGVYTAKDYADILEFLVGRWEIEKLTGLSGEGHKARDYVCGL
APRIRKLEERAQARAKQKAPVPFSWVFGKDIKL
Download this sequence
in fasta format
Download all sequences for 1.14.19.2
in fasta format
in csv (Excel, OpenOffice) format