Sequence of RND_ZYMMO

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
ribonuclease D
Q5NPM2
Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
390
43855
Reaction
exonucleolytic cleavage that removes extra residues from the 3'-terminus of tRNA to produce 5'-mononucleotides
Sequences with same EC No.
Sequence
show sequence in normal format
>Q5NPM2|ribonuclease D|EC 3.1.13.5|Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)|Swiss-Prot
MQIHPLITDSATLAALCSRLSRADFIAIDTEFIRENSYWPELCLIQIADDKEAAAIDPLA
PGLDMTPLTDLLVNNEDILKVFHAGGQDLEIILHHTGKMPFPLFDTQIAAMALGVGEQVG
YSNLVERYLSIKLDKGARFTDWSHRPLDRRQLDYAIADVTHLATLFPMLLKELRDKGRGA
WLDQEMERLADPSQYINDPEKSWLRIRMPNRKADILGRLKALAAWREIEAQNRNIPRGRI
AKDETLADLAIHPPRRQSDLVKVRGLSGSWGSNDIGQRLMEAIENAEALRPEEIPQRNDR
KLCIGKDGAMIADLLKLLLKMRARDAEVAARLIAKSDDIEGIIAGERENNPVLTGWRYDI
FGKEAIALIEGKMAFSVQKGKIAMTLIEKE
Download this sequence
in fasta format
Download all sequences for 3.1.13.5
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
343355
Seo J.-S.,Chong H.,Park H.S.,Yoon K.-O.,Jung C.,Kim J.J.,Hong J.H.,Kim H.,Kim J.-H.,Kil J.-I.,Park C.J.,Oh H.-M.,Lee J.-S.,Jin S.-J.,Um H.-W.,Lee H.-J.,Oh S.-J.,Kim J.Y.,Kang H.L.,Lee S.Y.,Lee K.J.,Kang H.S.
The genome sequence of the ethanologenic bacterium Zymomonas mobilis ZM4.
Nat. Biotechnol.
23
63-68
2005