Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of PON3_RAT

EC Number:3.1.8.1

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
aryldialkylphosphatase
Q68FP2
Rattus norvegicus
354
39458
Reaction
an aryl dialkyl phosphate + H2O = dialkyl phosphate + an aryl alcohol
Other sequences found for EC No. 3.1.8.1

General information:

Sequence
show sequence in normal format
>Q68FP2|aryldialkylphosphatase|EC 3.1.8.1|Rattus norvegicus|Swiss-Prot
MGKLVALTVLGASLALLGERLLNFRERVSTSREIKPTEPQNCHLIEGLENGSEDIDILPS
GLAFISTGLKYPGMPSFAPDKPGRIFLMDLNEPYPKAQALEISDGFDQDSLNPHGISTFI
DKDNTVYLYAVNHPHMDSTVEIFKFEEQPRSLVHLKTIKHELFESVNDIVVLGPEQFYAT
RDHYFTSHFLVLLEMILDPHWTSVLFYSPKEVKVVAQGFSSANGITVSLDQKYVYVADVT
AKNIHIMKKHNNWDLTPVKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLIYNPEDPPG
SEVLRIQDPLSDNPRVSTLYSNNGSVLQGSTVASVYHKKMLIGTIFHKALYCEL
Download this sequence
in fasta format
Download all sequences for 3.1.8.1
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
336016
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
Genome Res.
14
2121-2127
2004