Sequence of A0A024G6X4_9STRA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
pyruvate carboxylase
A0A024G6X4
Albugo candida
1149
126038
Reaction
ATP + pyruvate + HCO3- = ADP + phosphate + oxaloacetate
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A024G6X4|pyruvate carboxylase|EC 6.4.1.1|Albugo candida|TrEMBL
MAANRGEIATRIMRAGNELGLQTVGIFSKEDRFTQHRYKADESFLVGSDKTPVGAYLDIN
SIIHIAKSNEVDAIHPGYGFLSENVEFAKQCALHNIIFVGPTPENLKRFGDKTAARAMAI
KNNVPVIPGTDGPVRTLEQARQFINSGVDYPVIIKASMGGGGRGMRVVMREEELEESFHR
ASSEALAAFGDGTVFIERYLEKPRHIEVQILGDGKGNVVHLHHRDCSVQRRHQKVLETAP
AVGLPPDTEKALMEDAVRLTKASNYLNAGTVEFLVDQNGKHYFIEVNPRIQVEHTITEEI
TGVDLVQSQIRIAGGESFSELGLCQSSIQPRGHAMQCRVTTEDPSQNFRPDSGVIEVFRS
PGGMGIRLDDGPGFVGANITPHYDSLLVKVTARALDRSDCAHKLRRALQEFRVRGVTTNK
NFVLNVLKHPDFINGIIHTGFIGENPELLRPSASTNRAQKLLKYIGNTIVNGPDKALGAA
GPKALDQQPIVPSFQSSGRKTTSLRQIYKEKGPQAFAKAVRQHEGLLLTDTTWRDAHQSL
LATRLRSKDMETIAPATAIALKNAYSIEMWGGATFDVSMRFLREDPWDRLTRLRELVPDV
PFQMLLRGANAVGYTSYPDNVVFKFCEEAQQNGMDVFRVFDSLNYLENMRLGVDAVGAAG
GIIEAAVCYTGDVSDPARGPYNLEYYMEFTRQLVDLGIHVLAIKDMAGLLKPHAARLLVS
SIRKEFPDLPIHVHTHDTAGTGVSSMLECAYAGADAVDVATDAMSGTTSQPSMGAVVAAL
QGSKHDTQIDFNQINAVNEYWEAMRGAYAPFESGQKSGSADVYLHEMPGGQYTNLLYQST
QLGLTGQWPAIKKAYAAANRLLGDIIKVTPSSKVVGDLAQFLVQNQLTEEQVLEQAETLS
FPSSVVEYFQGHIGIPHHGFPEPLRSRVIKGKGFEGFRGRPGAELAPYDFAKAQRDLKEK
YGSENIRDVDVLSYALYPNVFDEFVQFKQQYGSMHFMDTKTFLQGLNIDEEIELEMEHGK
TVFIKLIAVGAVSKRDGMRDVIFELNGRQRVVRVKDEQAGVGVVVKPRAIHGLQGSVGAP
MPGVVLEVKVKIGQVVKEGTPLLVLSAMKMETVVTAPVSGRINMLSAGVGDNMLAGDLLV
EIDPTGDED
Download this sequence
in fasta format
Download all sequences for 6.4.1.1
in fasta format
in csv (Excel, OpenOffice) format