Any feedback?
Please rate this page
(sequences.php)
(0/150)

BRENDA support

Sequence of A0A377JWP2_9HELI

EC Number:3.4.13.5

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
Xaa-methyl-His dipeptidase
A0A377JWP2
Helicobacter cinaedi
455
50454
Reaction
Hydrolysis of anserine (beta-alanyl-/-Npi-methyl-L-histidine), carnosine, homocarnosine, glycyl-/-leucine and other dipeptides with broad specificity.
Other sequences found for EC No. 3.4.13.5

General information:

Sequence
show sequence in normal format
>A0A377JWP2|Xaa-methyl-His dipeptidase|EC 3.4.13.5|Helicobacter cinaedi|TrEMBL
MSDFSTRALEMFYKLCEIPHCSYHTQDMHAFLCSSLESQGYTLAVDSAFNIYAKKGKPKI
CLQGHYDMVCVGDSTKHRGVTPIQKDGFLYAKDSSLGADNGIALACMLALQESNIELLFT
NDEEVGMIGANNLNLKIESPLLLNLDSEDIHEIVLGCAGGVDIECNIDLKSDLKPLDSLL
PSYPYMYKITSSGFLGGHSGVEIHKNKENALSEFGFFLSTIEAYIITLNGGEKRNSIPVG
LEAIIACDKRLDSIFYTPNGASFDIKPLESLESSDYTNAYHKNAIAPLLCGIHSGVYAGD
KQGVLSSLNLSLITQKQESLELILMARANTETLLERTIERLEIMLPYLNPHCSMKTSGYY
APWEKSIEPTHKALTLLNTLYAKHNITPHLTQIHAGLECGILKRQILAHSNVKNFEILSI
GPTIHAPHSCNERLDLKDFEIFCDILQDFVTLYKE
Download this sequence
in fasta format
Download all sequences for 3.4.13.5
in fasta format
in csv (Excel, OpenOffice) format