Sequence of NIFH_RHILT

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
nitrogenase
P00461
Rhizobium leguminosarum bv. trifolii
297
31903
Reaction
8 reduced ferredoxin + 8 H+ + N2 + 16 ATP + 16 H2O = 8 oxidized ferredoxin + H2 + 2 NH3 + 16 ADP + 16 phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>P00461|nitrogenase|EC 1.18.6.1|Rhizobium leguminosarum bv. trifolii|Swiss-Prot
MAALRQIAFYGKGGIGKSTTSQNTLAALVELGQKILIVGCDPKADSTRLILNSKAQGTVL
DLAATKGSVEDLELGDVLKTGYGGIKCVESGGPEPGVGCAGRGVITSINFLEENGAYDDV
DYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMALYAANNIARGILKYASAGSVRL
GGLICNERQTDRELDLAEALAAKLNSKLIHFVPRDNIVQHAELRKMTVIQYAPRSKQAAE
YRWLAEKIHSNSGKGTIPTPITMEELEDMLLDFGIMKSDEQMLEELLAKEVQAAVAP
Download this sequence
in fasta format
Download all sequences for 1.18.6.1
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
306506
Scott K.F.,Rolfe B.G.,Shine J.
Biological nitrogen fixation: primary structure of the Rhizobium trifolii iron protein gene.
DNA
2
149-155
1983