Sequence of NIFH_RHILO

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
nitrogenase
Q98AP7
Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
297
32062
Reaction
8 reduced ferredoxin + 8 H+ + N2 + 16 ATP + 16 H2O = 8 oxidized ferredoxin + H2 + 2 NH3 + 16 ADP + 16 phosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q98AP7|nitrogenase|EC 1.18.6.1|Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)|Swiss-Prot
MSGLRQIAFYGKGGIGKSTTSQNTLAALVDLGQKILIVGCDPKADSTRLILNAKAQDTVL
HLAAQEGSVEDLELQDVLKIGYKDIKCVESGGPEPGVGCAGRGVITSINFLEENGAYDNV
DYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMALYAANNIAKGILKYAHSGGVRL
GGLICNERQTDRELDLSEALAARLNSKLIHFVPRDNIVQHAELRKMTVIQYAPDSKQAGE
YRALAEKIHGNSGQGTIPTPITMEELEDMLLDFGIMKTDEQMLAELQAKEAKLAVAQ
Download this sequence
in fasta format
Download all sequences for 1.18.6.1
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
306505
Kaneko T.,Nakamura Y.,Sato S.,Asamizu E.,Kato T.,Sasamoto S.,Watanabe A.,Idesawa K.,Ishikawa A.,Kawashima K.,Kimura T.,Kishida Y.,Kiyokawa C.,Kohara M.,Matsumoto M.,Matsuno A.,Mochizuki Y.,Nakayama S.,Nakazaki N.,Shimpo S.,Sugimoto M.,Takeuchi C.,Yamada M.,Tabata S.
Complete genome structure of the nitrogen-fixing symbiotic bacterium Mesorhizobium loti.
DNA Res.
7
331-338
2000