Sequence of LOX15_BOVIN

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
arachidonate 15-lipoxygenase
P27479
Bos taurus
663
75124
Reaction
arachidonate + O2 = (5Z,8Z,11Z,13E)-(15S)-15-hydroperoxyicosa-5,8,11,13-tetraenoate
Sequences with same EC No.
Sequence
show sequence in normal format
>P27479|arachidonate 15-lipoxygenase|EC 1.13.11.33|Bos taurus|Swiss-Prot
MGLYRVRVSTGSSFCAGSNNQVHLWLVGEHGEAALGWRLRPARGKEVEFQVDVSEYLGRL
LFVKLRKRHLLSDDAWFCNWISVQGPGASGNEFRFPCYRWVEGDGILSLPEGTGRTVVDD
PQGLFKKHREEELAERRKLYRWGNWKDGLILNIAGATINDLPVDERFLEDKRIDFEASLT
KGLADLAIKDSLNILTCWKSLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGTNPM
LLRRSVRLPARLEFPPGMGELQAELEKELQQGTLFEADFSLLDGIKANVILCTQQYVAAP
LVMLKLQPDGKLLPMAIQLQLPHKGSPPPPLFLPTDPPMTWLLAKCWVRSSDFQLHELHS
HLLRGHLVAEVIAVATMRCLPSIHPMFKLLIPHLRYTMEINIRARTGLVSDSGVFDQVVS
TGGGGHVELLQRAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEILSRYVEGIV
SLHYKTDESVRDDIELQAWCRDITEIGLLGAQDRGFPVTLQSKDQLCHFVTMCIFTCTGQ
HSSTHLGQLDWYSWVPNAPCTMRLPPPTTKDVTLEKVMATLPNFHQASLQMSITWQLGRR
QPIMVALGQHEEEYFSGPEPKAVLKKFREELAALEKDIEIRNAQLDWPYEYLRPSLVENS
VAI
Download this sequence
in fasta format
Download all sequences for 1.13.11.33
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
303506
de Marzo N.,Sloan D.L.,Dicharry S.,Highland E.,Sigal E.
Cloning and expression of an airway epithelial 12-lipoxygenase.
Am. J. Physiol.
262
0-0
1992
303507
Zimin A.V.,Delcher A.L.,Florea L.,Kelley D.R.,Schatz M.C.,Puiu D.,Hanrahan F.,Pertea G.,Van Tassell C.P.,Sonstegard T.S.,Marcais G.,Roberts M.,Subramanian P.,Yorke J.A.,Salzberg S.L.
A whole-genome assembly of the domestic cow, Bos taurus.
Genome Biol.
10
0-0
2009