Sequence of A0A6H9UX96_9ACTN

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
phenylalanine aminomutase (D-beta-phenylalanine forming)
A0A6H9UX96
Streptomyces sp. HIT-DPA4
524
56997
Reaction
L-phenylalanine = D-beta-phenylalanine
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A6H9UX96|phenylalanine aminomutase (D-beta-phenylalanine forming)|EC 5.4.3.11|Streptomyces sp. HIT-DPA4|TrEMBL
MTLTIKANQWITLEQLDAAAAGAVPVELDTEVWQRVRTSRETLEKFVENDRVIYGVNTSM
GGFVDWLVPVTMAQELQENLINAVATNVGQYLDDRTVRAIMLSRIVSLARGNSAISPANL
EKLIQIHNAGIAPCVPEKGSLGTSGDLGPLAAIALVGIGQWKARLEGEVMPGADALAKAG
IEPMTLSFKEGLALINGTSGMVGLGSLVFARARKLLDAYLMVSALSVEGLRGMTKPFDPR
VHELKPHRGQREIAKRLWDVLKDSAMAVNELDTETTLAGEMEDSAKHASQPIEDAYSIRC
TPQILGPVLDNMTQVARTLEDELNSSNDNPLVVPEENDVFHNGHFHGQYVSMAMDHLVIS
LATMTNLANRRIDRFLDKSNSNGLPAFLCRENPGLRLGLMGGQFMTASLTAETRAMAMPM
SIQSLTSTGDFQDIVSFGFVAARKAREALDNATYVVAFELLCACQAVDIRGGADALSSGT
RQLYERTRKLVPYLDRDVTITDYVEAIAREILGERPVAEAEALR
Download this sequence
in fasta format
Download all sequences for 5.4.3.11
in fasta format
in csv (Excel, OpenOffice) format