Sequence of FUZ7_USTMA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
mitogen-activated protein kinase kinase
Q99078
Ustilago maydis (strain 521 / FGSC 9021)
435
47201
Reaction
ATP + a protein = ADP + a phosphoprotein
Sequences with same EC No.
Sequence
show sequence in normal format
>Q99078|mitogen-activated protein kinase kinase|EC 2.7.12.2|Ustilago maydis (strain 521 / FGSC 9021)|Swiss-Prot
MLSSGAGSSIRKKRNFKGLQLAESPLASPVDASATTPSHKPGEGSAASNASTIGKSSAVT
PGGSLALPVKNGLDTEPNSGANYHNKLTQQLANLELGVEYKLDLKNEDLKTLSELGAGNG
GTVTKVLHEKSGTVMAKKVVFIDAKPSVRKQILRELQILHECNSPYIVSFYGAYLNEPHI
CMCMEFMQKDSLDGIYKKYGPISPEICGKIAVAVSHGLTYLYDVHRIIHRDVKPSNILVN
GAGQIKICDFGVSGELINSIADTFVGTSTYMSPERIQGDQYSVKSDVWSLGVSIIELALG
RFPFAENEEDDDSDADNNYTNEDLAGTLSPTKPAPMISLGQNEKQRRRKSKPAGVSLEGS
SHQMSILDLLQHIVNEPPPKLPEGRFPKHMEEFVNLCLLKDPAKRPTPKDLTKHQYVIDA
DAAKVDLQAWADGMK
Download this sequence
in fasta format
Download all sequences for 2.7.12.2
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
286086
Banuett F.,Herskowitz I.
Identification of fuz7, a Ustilago maydis MEK/MAPKK homolog required for a-locus-dependent and -independent steps in the fungal life cycle.
Genes Dev.
8
1367-1378
1994
286087
Kaemper J.,Kahmann R.,Boelker M.,Ma L.-J.,Brefort T.,Saville B.J.,Banuett F.,Kronstad J.W.,Gold S.E.,Mueller O.,Perlin M.H.,Woesten H.A.B.,de Vries R.,Ruiz-Herrera J.,Reynaga-Pena C.G.,Snetselaar K.,McCann M.,Perez-Martin J.,Feldbruegge M.,Basse C.W.,Steinberg G.,Ibeas J.I.,Holloman W.,Guzman P.,Farman M.L.,Stajich J.E.,Sentandreu R.,Gonzalez-Prieto J.M.,Kennell J.C.,Molina L.,Schirawski J.,Mendoza-Mendoza A.,Greilinger D.,Muench K.,Roessel N.,Scherer M.,Vranes M.,Ladendorf O.,Vincon V.,Fuchs U.,Sandrock B.,Meng S.,Ho E.C.H.,Cahill M.J.,Boyce K.J.,Klose J.,Klosterman S.J.,Deelstra H.J.,Ortiz-Castellanos L.,Li W.,Sanchez-Alonso P.,Schreier P.H.,Haeuser-Hahn I.,Vaupel M.,Koopmann E.,Friedrich G.,Voss H.,Schlueter T.,Margolis J.,Platt D.,Swimmer C.,Gnirke A.,Chen F.,Vysotskaia V.,Mannhaupt G.,Gueldener U.,Muensterkoetter M.,Haase D.,Oesterheld M.,Mewes H.-W.,Mauceli E.W.,DeCaprio D.,Wade C.M.,Butler J.,Young S.K.,Jaffe D.B.,Calvo S.E.,Nusbaum C.,Galagan J.E.,Birren B.W.
Insights from the genome of the biotrophic fungal plant pathogen Ustilago maydis.
Nature
444
97-101
2006