Sequence of CRTM_STAAW

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
4,4'-diapophytoene synthase
Q8NUQ5
Staphylococcus aureus (strain MW2)
287
34231
Reaction
2 (2E,6E)-farnesyl diphosphate = 15-cis-4,4'-diapophytoene + 2 diphosphate
Sequences with same EC No.
Sequence
show sequence in normal format
>Q8NUQ5|4,4'-diapophytoene synthase|EC 2.5.1.96|Staphylococcus aureus (strain MW2)|Swiss-Prot
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFL
NQIKEDIQSIEKYPYEHHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMF
ETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFDNE
RIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFQDVMDQIKVFSIEAQPI
IELAARIYIEILDEVRQANYTLHERVFVDKRKKAKLFHEINSKYHRI
Download this sequence
in fasta format
Download all sequences for 2.5.1.96
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
269970
Baba T.,Takeuchi F.,Kuroda M.,Yuzawa H.,Aoki K.,Oguchi A.,Nagai Y.,Iwama N.,Asano K.,Naimi T.,Kuroda H.,Cui L.,Yamamoto K.,Hiramatsu K.
Genome and virulence determinants of high virulence community-acquired MRSA.
Lancet
359
1819-1827
2002