Sequence of A0A448HM21_MYCFV

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
cholestanetriol 26-monooxygenase
A0A448HM21
Mycolicibacterium flavescens
414
45413
Reaction
(25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-al + 2 reduced adrenodoxin + 2 H+ + O2 = (25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oate + 2 oxidized adrenodoxin + H2O
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A448HM21|cholestanetriol 26-monooxygenase|EC 1.14.15.15|Mycolicibacterium flavescens|TrEMBL
MSVTVNVDTDRPSPTVFEADLPTLSYEDATDAYEAHRRIAEARNAGPVAMGAHGPELLSY
ETVRSALRDHRMCVPPGLGLEAQGITSGPLWDRAVTTLLSVNGETHSRLRRLVCKAFTPR
SVGRLETTITTVITDLVDPLVASGQCEVVEDIARPYPVPVIAELLGAPREDWKLFSEWAD
DFFKLFEWNAAEHAPLILQAWAELDDYIDGMVAERRTTLTDDLISELIRAEDDGDRLSIE
ELRMLAAGILMAGTDTTRNQLAAAVDVLCDHPDQWELLAEHPELAMNAVEELMRFYPVVF
GAMRMTVEDVTYGGVTIPAGTFVLINSASANRDPAVYDDADRLDITRQGAAPMQTFGAGA
HYCLGANLARRELAEALVVMSSRVRNLRRAGPAMWKPLVGITGPATLPIEFDAR
Download this sequence
in fasta format
Download all sequences for 1.14.15.15
in fasta format
in csv (Excel, OpenOffice) format