Sequence of AT1A1_XENLA

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
Na+/K+-exchanging ATPase
Q92123
Xenopus laevis
1025
113084
Reaction
ATP + H2O + Na+[side 1] + K+[side 2] = ADP + phosphate + Na+[side 2] + K+[side 1]
Sequences with same EC No.
Sequence
show sequence in normal format
>Q92123|Na+/K+-exchanging ATPase|EC 7.2.2.13|Xenopus laevis|Swiss-Prot
MGYGAGRDKYEPAATSEQGGKKKKGKGKGKEKDMDELKKEVTMEDHKLSLDELHRKFGTD
MQRGLTTARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGIQ
AAMEEEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRSGEKL
SINAEEVVLGDLVEVKGGDRIPADLRVISSHGCKVDNSSLTGESEPQTRSPDFTNENPLE
TRNIAFFSTNCVEGTARGIVVNTGDRTVMGRIATLASGLDGGRTPIAIEIEHFIHIITGV
AVFLGVSFFILSLILQYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLV
KNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGASFDKSSPTW
TALSRVAGLCNRAVFQAGQENTPILKRDVAGDASESALLKCIELCCGSVRDMREKNHKVA
EIPFNSTNKYQLSVHKNANPSESRYILVMKGAPERILDRCTSIILQGKEQPLDEELKDAF
QNAYLELGGLGERVLGFCHLALPDDQFPDGFQFDTEEVNFPTENLCFVGLISMIDPPRAA
VPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPR
DAKACVIHGTDLKDMTEEQIDDILRHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDG
VNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAY
TLTSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRN
PKTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPWTLLGIRVNWDDRWTNDV
EDSYGQQWTYEQRKIVEFTCHTSFFISIVVVQWADLIICKTRRNSVFQQGMKNKILIFGL
FEETALAAFLSYCPGMDVALRMYPLKPTWWFCAFPYSLIIFIYDEVRKLIIRRSPGGWVE
KESYY
Download this sequence
in fasta format
Download all sequences for 7.2.2.13
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
257080
Verrey F.,Kairouz P.,Schaerer E.,Fuentes P.,Geering K.,Rossier B.C.,Kraehenbuhl J.-P.
Primary sequence of Xenopus laevis Na+-K+-ATPase and its localization in A6 kidney cells.
Am. J. Physiol.
256
0-0
1989
257081
Davies C.S.,Messenger N.J.,Craig R.,Warner A.E.
Primary sequence and developmental expression pattern of mRNAs and protein for an alpha1 subunit of the sodium pump cloned from the neural plate of Xenopus laevis.
Dev. Biol.
174
431-447
1996