Sequence of A0A5C4QJ19_9ACTN

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
4-aminobutyrate-2-oxoglutarate transaminase
A0A5C4QJ19
Micromonospora orduensis
423
44012
Reaction
4-aminobutanoate + 2-oxoglutarate = succinate semialdehyde + L-glutamate
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A5C4QJ19|4-aminobutyrate-2-oxoglutarate transaminase|EC 2.6.1.19|Micromonospora orduensis|TrEMBL
MASSEELHKRRGGAVARGVGSVISSYVDTASGGTITDVDGREWIDFAAGIAVSSVGNSAP
KVVEAVRAQVERFTHTCFMVAPYESYVAVCEQLNAVTPGGFEKRSALFNSGAEAVENAVK
IARHATGRPAVVVFDHAYHGRTNLTMALTAKNMPYKHRFGPFAGEIYRVPMSYPLRDGGL
SGAEAAARAIEMVEKQVGAENVAALLIEPIQGEGGFVVPAPGFLPALRAWATAAGVVFVA
DEIQTGFCRTGDWFACQHESVEPDLVALAKGIAGGLPLAAVTGRAELMDAVHVGGLGGTY
GGNPIACAAALATIETMHELDLAAAARRIESVLAPRLRAAAERDPRIAEVRGRGAMLAVE
LVRPGTLVPDPVATAAVSAACHAAGLLTLTCGTYGNVLRFLPPLVISDEQLTRGADILDA
AFG
Download this sequence
in fasta format
Download all sequences for 2.6.1.19
in fasta format
in csv (Excel, OpenOffice) format