Sequence of ACE_MESAU

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
peptidyl-dipeptidase A
Q50JE5
Mesocricetus auratus
1314
151595
Reaction
release of a C-terminal dipeptide, oligopeptide-/-Xaa-Yaa, when Xaa is not Pro, and Yaa is neither Asp nor Glu. Thus, conversion of angiotensin I to angiotensin II, with increase in vasoconstrictor activity, but no action on angiotensin II
Sequences with same EC No.
Sequence
show sequence in normal format
>Q50JE5|peptidyl-dipeptidase A|EC 3.4.15.1|Mesocricetus auratus|Swiss-Prot
MGAASGQRGQGPPSPLLLLWLSLLLLLLPPSPAPALDPGLQPGNFSADEIGAHLFAESYN
SSAEQVIFQSTVASWAYDTNMTEENARLQEEAELIWQEFAEVWGKKAKELFDAIRQNFTD
SKLRRVIETIRTLGPANLPLARRQQYNSLQNNMNRIYSTSKVCLPNKTATCWSLEPELTN
ILASSRSYAKLLFAWESWHDVVGIPLKPLYQDFTALSNEAYKQDGFSDTGAYWRSAYDSP
SFEETLEHLYHQLEPLYLNLHAYVRRALHRRYGDKYINLRGPIPAHLLGDMWAQSWDNIY
DMVVPFPNKPNLDVTNTMVQKGWNVTHMFRVAEEFFTSMGLSPMPPEFWAESMLEKPTDG
REVVCHASAWDFFNRKDFRIKQCTRITMEQLSTVHHEMGHVQYYLQYKDLTVPLRRGANP
GFHEAIGDVLALSVSTPAHLHKIGLLDRVANDLESDINYLLKMALEKIAFLPFGYLVDQW
RWGVFSGHTPPSRYNFDWWYFRTKYQGICPPVVRNETHFDAGAKFHIPSGTPYIRYFVSF
ILQFQFHQALCKEAGHQGPLHQCDIYQSTQAGAKLQRVLQAGYSRPWQEVLKEMVGSDTL
DAQALLEYFQPVIRWLQEQNQRNGEVLGWPEYQWRPPLPDNYPEGIDLVTDETEAERFVE
EYDRTARVLWNEYAEANWQYNTNITLEASKILLQKNKKVANHTLKYGTLAKKFDVSNFQN
YTIKRIIKKVQNMDRAVLPPKELEEYNQILMDMETTYSIANVCYLNGTCLHLEPDLTNVM
ATSRKYEELLWVWKSWRDKVGRAILPLFPKYVELSNKIAHLNGYADGGDSWRSSYESKSL
EQDLEQLYQELQPLYLNLHAYVRRSLHRHYGSQHINLDGPIPAHLLGNMWAQTWSNIYDL
VAPFPSAPNLDATEAMIKQGWTPRRIFKEADDFFTSLGLLPVSEEFWNKSMLEKPGDGRE
VVCHASAWDFYNGKDFRIKQCTSVNMEDLVIAHHEMGHIQYFMQYKDLPVTFREGANPGF
HEAIGDVLALSVSTPKHLHSLNLLSSEGGGYEHDINFLMKMALDKIAFIPFSYLIDQWRW
RVFDGSITKENYNQEWWSLRLKYQGLCPPVPRSQDDFDPGSKFHVPANVPYIRYFVSFII
QFQFHEALCRAAGHTGPLHKCDIYQSKEAGKLLADTMKMGYSKPWPEAMKLITGQPNMSA
SAMMNYFKPLTEWLVTENRRHGETLGWPEYNWTPNTARSEGPFPESGRVNFLGMYLEPQQ
ARVGQWVLLFLGVSLLVATLGLTHRLFSIRQHGHSLHRPHRGPQFGSEVELRHS
Download this sequence
in fasta format
Download all sequences for 3.4.15.1
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
249341
Uchide T.,Fujimori Y.,Fukushima U.,Uechi M.,Sasaki T.,Temma K.
cDNA cloning of hamster angiotensin-converting enzyme and mRNA expression.
DNA Seq.
17
319-325
2006