Sequence of 3HAO_SHEWM

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
3-hydroxyanthranilate 3,4-dioxygenase
B1KJM7
Shewanella woodyi (strain ATCC 51908 / MS32)
189
21866
Reaction
3-hydroxyanthranilate + O2 = 2-amino-3-carboxymuconate semialdehyde
Sequences with same EC No.
Sequence
show sequence in normal format
>B1KJM7|3-hydroxyanthranilate 3,4-dioxygenase|EC 1.13.11.6|Shewanella woodyi (strain ATCC 51908 / MS32)|Swiss-Prot
MSKLAAFNFQQWIDEHQHLLKPPVGNVQIWENTDMMVTVVGGPNQRTDFHDDPVEEFFYQ
LKGDMVLKIIEEGKCHDLFIREGDIFFLPPHVRHSPQRPMPGSIGLVIEPKRPEGAKDAF
EWYCFKCDGLVHRVEVLLKSIVRDLPPIYQAFYQDEQARTCPQCGELHPGKEPPQGWVTL
LENKEQDKS
Download this sequence
in fasta format
Download all sequences for 1.13.11.6
in fasta format
in csv (Excel, OpenOffice) format