Sequence of XYLT_ARATH

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
glycoprotein 2-beta-D-xylosyltransferase
Q9LDH0
Arabidopsis thaliana
534
60235
Reaction
UDP-alpha-D-xylose + N4-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc]-L-asparaginyl-[protein] = UDP + N4-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-[beta-D-Xyl-(1->2)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc]-L-asparaginyl-[protein]
Sequences with same EC No.
Sequence
show sequence in normal format
>Q9LDH0|glycoprotein 2-beta-D-xylosyltransferase|EC 2.4.2.38|Arabidopsis thaliana|Swiss-Prot
MSKRNPKILKIFLYMLLLNSLFLIIYFVFHSSSFSPEQSQPPHIYHVSVNNQSAIQKPWP
ILPSYLPWTPPQRNLPTGSCEGYFGNGFTKRVDFLKPRIGGGGEGSWFRCFYSETLQSSI
CEGRNLRMVPDRIVMSRGGEKLEEVMGRKEEEELPAFRQGAFEVAEEVSSRLGFKRHRRF
GGGEGGSAVSRRLVNDEMLNEYMQEGGIDRHTMRDLVASIRAVDTNDFVCEEWVEEPTLL
VTRFEYANLFHTVTDWYSAYVSSRVTGLPNRPHVVFVDGHCTTQLEETWTALFSGIRYAK
NFTKPVCFRHAILSPLGYETALFKGLSGEIDCKGDSAHNLWQNPDDKRTARISEFGEMIR
AAFGLPVNRHRSLEKPLSSSSSSASVYNVLFVRREDYLAHPRHGGKVQSRLINEEEVFDS
LHHWVATGSTGLTKCGINLVNGLLAHMSMKDQVRAIQDASVIIGAHGAGLTHIVSATPNT
TIFEIISVEFQRPHFELIAKWKGLEYHAMHLANSRAEPTAVIEKLTEIMKSLGC
Download this sequence
in fasta format
Download all sequences for 2.4.2.38
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
242010
Strasser R.,Mucha J.,Mach L.,Altmann F.,Wilson I.B.H.,Gloessl J.,Steinkellner H.
Molecular cloning and functional expression of beta 1,2-xylosyltransferase cDNA from Arabidopsis thaliana.
FEBS Lett.
472
105-108
2000
242013
Nakamura Y.,Sato S.,Asamizu E.,Kaneko T.,Kotani H.,Miyajima N.,Tabata S.
Structural analysis of Arabidopsis thaliana chromosome 5. VII. Sequence features of the regions of 1,013,767 bp covered by sixteen physically assigned P1 and TAC clones.
DNA Res.
5
297-308
1998
242014
Cheng C.Y.,Krishnakumar V.,Chan A.P.,Thibaud-Nissen F.,Schobel S.,Town C.D.
Araport11: a complete reannotation of the Arabidopsis thaliana reference genome.
Plant J.
89
789-804
2017
242015
Yamada K.,Lim J.,Dale J.M.,Chen H.,Shinn P.,Palm C.J.,Southwick A.M.,Wu H.C.,Kim C.J.,Nguyen M.,Pham P.K.,Cheuk R.F.,Karlin-Newmann G.,Liu S.X.,Lam B.,Sakano H.,Wu T.,Yu G.,Miranda M.,Quach H.L.,Tripp M.,Chang C.H.,Lee J.M.,Toriumi M.J.,Chan M.M.,Tang C.C.,Onodera C.S.,Deng J.M.,Akiyama K.,Ansari Y.,Arakawa T.,Banh J.,Banno F.,Bowser L.,Brooks S.Y.,Carninci P.,Chao Q.,Choy N.,Enju A.,Goldsmith A.D.,Gurjal M.,Hansen N.F.,Hayashizaki Y.,Johnson-Hopson C.,Hsuan V.W.,Iida K.,Karnes M.,Khan S.,Koesema E.,Ishida J.,Jiang P.X.,Jones T.,Kawai J.,Kamiya A.,Meyers C.,Nakajima M.,Narusaka M.,Seki M.,Sakurai T.,Satou M.,Tamse R.,Vaysberg M.,Wallender E.K.,Wong C.,Yamamura Y.,Yuan S.,Shinozaki K.,Davis R.W.,Theologis A.,Ecker J.R.
Empirical analysis of transcriptional activity in the Arabidopsis genome.
Science
302
842-846
2003
242016
Dirnberger D.,Bencur P.,Mach L.,Steinkellner H.
The Golgi localization of Arabidopsis thaliana beta1,2-xylosyltransferase in plant cells is dependent on its cytoplasmic and transmembrane sequences.
Plant Mol. Biol.
50
273-281
2002
242017
Pagny S.,Bouissonnie F.,Sarkar M.,Follet-Gueye M.L.,Driouich A.,Schachter H.,Faye L.,Gomord V.
Structural requirements for Arabidopsis beta1,2-xylosyltransferase activity and targeting to the Golgi.
Plant J.
33
189-203
2003
242018
Strasser R.,Altmann F.,Mach L.,Gloessl J.,Steinkellner H.
Generation of Arabidopsis thaliana plants with complex N-glycans lacking beta1,2-linked xylose and core alpha1,3-linked fucose.
FEBS Lett.
561
132-136
2004
242019
Bencur P.,Steinkellner H.,Svoboda B.,Mucha J.,Strasser R.,Kolarich D.,Hann S.,Koellensperger G.,Gloessl J.,Altmann F.,Mach L.
Arabidopsis thaliana beta1,2-xylosyltransferase: an unusual glycosyltransferase with the potential to act at multiple stages of the plant N-glycosylation pathway.
Biochem. J.
388
515-525
2005
242020
Kajiura H.,Okamoto T.,Misaki R.,Matsuura Y.,Fujiyama K.
Arabidopsis beta1,2-xylosyltransferase: substrate specificity and participation in the plant-specific N-glycosylation pathway.
J. Biosci. Bioeng.
113
48-54
2012