Sequence of A0A3S9H4C1_9FIRM

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
Cd2+-exporting ATPase
A0A3S9H4C1
Halocella sp. SP3-1
739
81613
Reaction
ATP + H2O + Cd2+[side 1] = ADP + phosphate + Cd2+[side 2]
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A3S9H4C1|Cd2+-exporting ATPase|EC 7.2.2.21|Halocella sp. SP3-1|TrEMBL
MNYGRKNIMAEAVLVKNEFKTKYILRGLACTSCAAKIEKAVQELPYVVEAELNLAASTII
IKGSERTKNMDKELQFIADKIENGVKVEKEGKRTLRQENNTSKKERAKDNTDITKKSNYQ
YRFWSGVGIFILALISLQVPILTDGFFNFYFKYFLFGSSYLLIGSPVLIAAFKNIKRGQV
FDENFLMSIATLGAFAIQEFPEGVAVMLFYMVGEMFQEKAVDHSRRSIKDLMDIRPDYAN
LKQGEKTIKIAPEDVQVGDIIVIKPGERVPLDGEVLKGSSLVDTSALTGESVPRRVKSGE
EILSGMINKTGLLTVKVNKEYNQSTVAQILDLVENASAKKAAIEKFITKFSRYYTPVVVY
SALAIAILPPLFLAGASFSDWLYRSLIFLVVSCPCALVVSIPLGFFGGIGRASRQGILVK
GGNYLEALNDVKQIVFDKTGTLTKGEFVVSKIKPYNNHSKDEILIKAAYAESHSTHPIAK
SILEACEYKIDNNKIEDYQEFSGRGIKAVIDGQEVLVGNNKLMDQEQIDYQEVTEEATEA
TIVYIAIDNVYAGYITIADHLKDDSLKAIKALKQAGIREITMFTGDRENVAQEIAKRLGL
DNYYAELLPAQKVEKVEELLKKQDKKDKLIFVGDGINDAPVLARSDIGVAMGGLGSDAAI
EAADVVLMTDEPSKLVTAINTAHKTRQIIWQNIIFALGIKGIVLIMGTLGIATMWEAVFA
DAGVALLAVLNAMRISRNP
Download this sequence
in fasta format
Download all sequences for 7.2.2.21
in fasta format
in csv (Excel, OpenOffice) format