Sequence of A0A2H5VUK3_9BACT

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
sulfoacetaldehyde dehydrogenase
A0A2H5VUK3
bacterium HR09
275
30094
Reaction
2-sulfoacetaldehyde + H2O + NAD+ = sulfoacetate + NADH + 2 H+
Sequences with same EC No.
Sequence
show sequence in normal format
>A0A2H5VUK3|sulfoacetaldehyde dehydrogenase|EC 1.2.1.73|bacterium HR09|TrEMBL
MLPCAGDAVQQLLEAPEVRLLTFTGSAAVGWNLKKQCWDKRVTLELGGNAAVIVEKDAGD
PEVIAHRIALGAFAYAGQSCISVQRVLVAKELYQTMREALVAAAERFPTGNPTDSQVLCG
PMISAYDAQRIVDWIESARTRGATLLTRFRREGSVVWPALLENVPHDHPLWCEEAFAPVA
VLEPFEDFAEAIAKVNDSRFGLQCGVFTRDWGKIQQAWEGIEVGAVIGNDIPSWRTDPMP
YGGVKQSGFGREGPAWAFEEMTELRLLVLTKPPGA
Download this sequence
in fasta format
Download all sequences for 1.2.1.73
in fasta format
in csv (Excel, OpenOffice) format